+ USE_DATABASE_REPLICATED=0
+ USE_SHARED_CATALOG=0
++ rg -v '#' /usr/share/zoneinfo/zone.tab
++ awk '{print $3}'
++ shuf
++ head -n1
+ TZ=Europe/Prague
+ echo 'Chosen random timezone Europe/Prague'
+ ln -snf /usr/share/zoneinfo/Europe/Prague /etc/localtime
Chosen random timezone Europe/Prague
+ echo Europe/Prague
+ dpkg -i package_folder/clickhouse-common-static_24.8.14.10505.altinitytest_amd64.deb
Selecting previously unselected package clickhouse-common-static.
(Reading database ... 48426 files and directories currently installed.)
Preparing to unpack .../clickhouse-common-static_24.8.14.10505.altinitytest_amd64.deb ...
Unpacking clickhouse-common-static (24.8.14.10505.altinitytest) ...
Setting up clickhouse-common-static (24.8.14.10505.altinitytest) ...
+ dpkg -i package_folder/clickhouse-common-static-dbg_24.8.14.10505.altinitytest_amd64.deb
Selecting previously unselected package clickhouse-common-static-dbg.
(Reading database ... 48453 files and directories currently installed.)
Preparing to unpack .../clickhouse-common-static-dbg_24.8.14.10505.altinitytest_amd64.deb ...
Unpacking clickhouse-common-static-dbg (24.8.14.10505.altinitytest) ...
Setting up clickhouse-common-static-dbg (24.8.14.10505.altinitytest) ...
+ dpkg -i package_folder/clickhouse-odbc-bridge_24.8.14.10505.altinitytest_amd64.deb
Selecting previously unselected package clickhouse-odbc-bridge.
(Reading database ... 48460 files and directories currently installed.)
Preparing to unpack .../clickhouse-odbc-bridge_24.8.14.10505.altinitytest_amd64.deb ...
Unpacking clickhouse-odbc-bridge (24.8.14.10505.altinitytest) ...
Setting up clickhouse-odbc-bridge (24.8.14.10505.altinitytest) ...
+ dpkg -i package_folder/clickhouse-library-bridge_24.8.14.10505.altinitytest_amd64.deb
Selecting previously unselected package clickhouse-library-bridge.
(Reading database ... 48466 files and directories currently installed.)
Preparing to unpack .../clickhouse-library-bridge_24.8.14.10505.altinitytest_amd64.deb ...
Unpacking clickhouse-library-bridge (24.8.14.10505.altinitytest) ...
Setting up clickhouse-library-bridge (24.8.14.10505.altinitytest) ...
+ dpkg -i package_folder/clickhouse-server_24.8.14.10505.altinitytest_amd64.deb
Selecting previously unselected package clickhouse-server.
(Reading database ... 48472 files and directories currently installed.)
Preparing to unpack .../clickhouse-server_24.8.14.10505.altinitytest_amd64.deb ...
Unpacking clickhouse-server (24.8.14.10505.altinitytest) ...
Setting up clickhouse-server (24.8.14.10505.altinitytest) ...
ClickHouse binary is already located at /usr/bin/clickhouse
Symlink /usr/bin/clickhouse-server already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-server to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-client to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-local to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-benchmark to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-obfuscator to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-git-import to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-compressor to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-format to /usr/bin/clickhouse.
Symlink /usr/bin/clickhouse-extract-from-config already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-extract-from-config to /usr/bin/clickhouse.
Symlink /usr/bin/clickhouse-keeper already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-keeper to /usr/bin/clickhouse.
Symlink /usr/bin/clickhouse-keeper-converter already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-keeper-converter to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-disks to /usr/bin/clickhouse.
Creating symlink /usr/bin/ch to /usr/bin/clickhouse.
Creating symlink /usr/bin/chl to /usr/bin/clickhouse.
Creating symlink /usr/bin/chc to /usr/bin/clickhouse.
Creating clickhouse group if it does not exist.
groupadd -r clickhouse
Creating clickhouse user if it does not exist.
useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse clickhouse
Will set ulimits for clickhouse user in /etc/security/limits.d/clickhouse.conf.
Creating config directory /etc/clickhouse-server/config.d that is used for tweaks of main server configuration.
Creating config directory /etc/clickhouse-server/users.d that is used for tweaks of users configuration.
Config file /etc/clickhouse-server/config.xml already exists, will keep it and extract path info from it.
/etc/clickhouse-server/config.xml has /var/lib/clickhouse/ as data path.
/etc/clickhouse-server/config.xml has /var/log/clickhouse-server/ as log path.
Users config file /etc/clickhouse-server/users.xml already exists, will keep it and extract users info from it.
Log directory /var/log/clickhouse-server/ already exists.
Creating data directory /var/lib/clickhouse/.
Creating pid directory /var/run/clickhouse-server.
chown -R clickhouse:clickhouse '/var/log/clickhouse-server/'
chown -R clickhouse:clickhouse '/var/run/clickhouse-server'
chown clickhouse:clickhouse '/var/lib/clickhouse/'
groupadd -r clickhouse-bridge
useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse-bridge clickhouse-bridge
chown -R clickhouse-bridge:clickhouse-bridge '/usr/bin/clickhouse-odbc-bridge'
chown -R clickhouse-bridge:clickhouse-bridge '/usr/bin/clickhouse-library-bridge'
Password for the default user is an empty string. See /etc/clickhouse-server/users.xml and /etc/clickhouse-server/users.d to change it.
Setting capabilities for clickhouse binary. This is optional.
chown -R clickhouse:clickhouse '/etc/clickhouse-server'
ClickHouse has been successfully installed.
Start clickhouse-server with:
sudo clickhouse start
Start clickhouse-client with:
clickhouse-client
+ dpkg -i package_folder/clickhouse-client_24.8.14.10505.altinitytest_amd64.deb
Selecting previously unselected package clickhouse-client.
(Reading database ... 48489 files and directories currently installed.)
Preparing to unpack .../clickhouse-client_24.8.14.10505.altinitytest_amd64.deb ...
Unpacking clickhouse-client (24.8.14.10505.altinitytest) ...
Setting up clickhouse-client (24.8.14.10505.altinitytest) ...
+ echo ''
+ [[ -z '' ]]
+ ch --query 'SELECT 1'
1
+ chl --query 'SELECT 1'
1
+ chc --version
ClickHouse client version 24.8.14.10505.altinitytest (altinity build).
+ ln -s /usr/share/clickhouse-test/clickhouse-test /usr/bin/clickhouse-test
+ source /attach_gdb.lib
++ source /utils.lib
+++ sysctl kernel.core_pattern=core.%e.%p-%P
kernel.core_pattern = core.%e.%p-%P
+++ sysctl fs.suid_dumpable=1
fs.suid_dumpable = 1
+ source /utils.lib
++ sysctl kernel.core_pattern=core.%e.%p-%P
kernel.core_pattern = core.%e.%p-%P
++ sysctl fs.suid_dumpable=1
fs.suid_dumpable = 1
+ /usr/share/clickhouse-test/config/install.sh
+ DEST_SERVER_PATH=/etc/clickhouse-server
+ DEST_CLIENT_PATH=/etc/clickhouse-client
+++ dirname /usr/share/clickhouse-test/config/install.sh
++ cd /usr/share/clickhouse-test/config
++ pwd -P
+ SRC_PATH=/usr/share/clickhouse-test/config
+ echo 'Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server'
+ mkdir -p /etc/clickhouse-server/config.d/
Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server
+ mkdir -p /etc/clickhouse-server/users.d/
+ mkdir -p /etc/clickhouse-client
+ ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_write.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/max_num_to_warn.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/listen.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/text_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/blob_storage_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/custom_settings_prefixes.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/database_catalog_drop_table_concurrency.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_access_control_improvements.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/macros.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/secure_ports.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/clusters.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/graphite.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/graphite_alternative.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/grpc_protocol.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/database_atomic.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/max_concurrent_queries.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_settings.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/backoff_failed_mutation.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_old_dirs_cleanup.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/test_cluster_with_incorrect_pw.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/keeper_port.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/logging_no_rotate.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/lost_forever_check.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/tcp_with_proxy.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/prometheus.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_lists.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_path.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/transactions.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/encryption.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/CORS.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/logger_trace.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/named_collection.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/ssl_certs.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_cache_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/session_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/system_unfreeze.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_zero_copy_replication.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/nlp.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/forbidden_headers.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_keeper_map.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/custom_disks_base_path.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/display_name.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/compressed_marks_and_index.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/disable_s3_env_credentials.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_wait_for_shutdown_replicated_tables.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/backups.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_caches_path.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/validate_tcp_client_information.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/zero_copy_destructive_operations.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/block_number.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/handlers.yaml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/serverwide_trace_collector.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/rocksdb.xml /etc/clickhouse-server/config.d/
+ '[' /etc/clickhouse-server = /etc/clickhouse-server ']'
+ ln -sf /usr/share/clickhouse-test/config/config.d/legacy_geobase.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/log_queries.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/readonly.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/access_management.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/database_atomic_drop_detach_sync.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/opentelemetry.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/remote_queries.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/session_log_test.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/memory_profiler.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/no_fsync_metadata.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/filelog.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/enable_blobs_check.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/marks.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/insert_keeper_retries.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/prefetch_settings.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/nonconst_timezone.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/allow_introspection_functions.yaml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/replicated_ddl_entry.xml /etc/clickhouse-server/users.d/
+ [[ -n '' ]]
+ ln -sf /usr/share/clickhouse-test/config/users.d/timeouts.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/ints_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/strings_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/decimals_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/executable_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/executable_pool_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/test_function.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/top_level_domains /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/regions_hierarchy.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/regions_names_en.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/ext-en.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/ext-ru.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/lem-en.bin /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/server.key /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/server.crt /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/dhparam.pem /etc/clickhouse-server/
+ ln -sf --backup=simple --suffix=_original.xml /usr/share/clickhouse-test/config/config.d/query_masking_rules.xml /etc/clickhouse-server/config.d/
+ [[ -n '' ]]
+ rm -f /etc/clickhouse-server/config.d/zookeeper_fault_injection.xml
+ ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper.xml /etc/clickhouse-server/config.d/
+ [[ -n '' ]]
+ rm -f /etc/clickhouse-server/config.d/cannot_allocate_thread_injection.xml
+ value=0
+ sed --follow-symlinks -i 's|[01]|0|' /etc/clickhouse-server/config.d/keeper_port.xml
+ value=38424576
+ sed --follow-symlinks -i 's|[[:digit:]]\+|38424576|' /etc/clickhouse-server/config.d/keeper_port.xml
+ value=19732480
+ sed --follow-symlinks -i 's|[[:digit:]]\+|19732480|' /etc/clickhouse-server/config.d/keeper_port.xml
+ [[ -n '' ]]
+ [[ -n '' ]]
+ [[ '' == \1 ]]
+ [[ '' == \1 ]]
+ [[ -n 1 ]]
+ ln -sf /usr/share/clickhouse-test/config/config.d/azure_storage_conf.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02944.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02963.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02961.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache_new.xml /etc/clickhouse-server/users.d/
+ [[ -n 0 ]]
+ [[ 0 -eq 1 ]]
+ ln -sf /usr/share/clickhouse-test/config/client_config.xml /etc/clickhouse-client/config.xml
+ [[ -n 0 ]]
+ [[ 0 -eq 1 ]]
+ ./setup_minio.sh stateless
+ azurite-blob --blobHost 0.0.0.0 --blobPort 10000 --debug /azurite_log
+ export MINIO_ROOT_USER=clickhouse
+ MINIO_ROOT_USER=clickhouse
+ export MINIO_ROOT_PASSWORD=clickhouse
+ MINIO_ROOT_PASSWORD=clickhouse
+ main stateless
+ local query_dir
++ check_arg stateless
++ local query_dir
++ '[' '!' 1 -eq 1 ']'
++ case "$1" in
++ query_dir=0_stateless
++ echo 0_stateless
+ query_dir=0_stateless
+ '[' '!' -f ./minio ']'
+ start_minio
+ mkdir -p ./minio_data
+ ./minio --version
minio version RELEASE.2024-08-03T04-33-23Z (commit-id=6efb56851c40da88d1ca15112e2d686a4ecec6b3)
Runtime: go1.22.5 linux/amd64
License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html
Copyright: 2015-2024 MinIO, Inc.
+ wait_for_it
+ local counter=0
+ local max_counter=60
+ local url=http://localhost:11111
+ params=('--silent' '--verbose')
+ local params
+ ./minio server --address :11111 ./minio_data
+ curl --silent --verbose http://localhost:11111
+ grep AccessDenied
trying to connect to minio
+ [[ 0 == \6\0 ]]
+ echo 'trying to connect to minio'
+ sleep 1
Azurite Blob service is starting on 0.0.0.0:10000
Azurite Blob service successfully listens on http://0.0.0.0:10000
INFO: Formatting 1st pool, 1 set(s), 1 drives per set.
INFO: WARNING: Host local has more than 0 drives of set. A host failure will result in data becoming unavailable.
MinIO Object Storage Server
Copyright: 2015-2025 MinIO, Inc.
License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html
Version: RELEASE.2024-08-03T04-33-23Z (go1.22.5 linux/amd64)
API: http://172.17.0.2:11111 http://127.0.0.1:11111
WebUI: http://172.17.0.2:41085 http://127.0.0.1:41085
Docs: https://min.io/docs/minio/linux/index.html
+ counter=1
+ curl --silent --verbose http://localhost:11111
+ grep AccessDenied
AccessDeniedAccess Denied./184C4E4D26D441277dc7eb22d3288ec80374614e9088e31d3668a6922ead55932dd2a8e56373820f
+ lsof -i :11111
COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME
minio 296 root 8u IPv4 26178 0t0 TCP localhost:11111 (LISTEN)
minio 296 root 9u IPv6 26179 0t0 TCP *:11111 (LISTEN)
minio 296 root 10u IPv6 26180 0t0 TCP localhost:11111 (LISTEN)
+ sleep 5
+ setup_minio stateless
+ local test_type=stateless
+ ./mc alias set clickminio http://localhost:11111 clickhouse clickhouse
Added `clickminio` successfully.
+ ./mc admin user add clickminio test testtest
Added user `test` successfully.
+ ./mc admin policy attach clickminio readwrite --user=test
Attached Policies: [readwrite]
To User: test
+ ./mc mb --ignore-existing clickminio/test
Bucket created successfully `clickminio/test`.
+ '[' stateless = stateless ']'
+ ./mc anonymous set public clickminio/test
Access permission for `clickminio/test` is set to `public`
+ upload_data 0_stateless /usr/share/clickhouse-test
+ local query_dir=0_stateless
+ local test_path=/usr/share/clickhouse-test
+ local data_path=/usr/share/clickhouse-test/queries/0_stateless/data_minio
+ '[' -d /usr/share/clickhouse-test/queries/0_stateless/data_minio ']'
+ ./mc cp --recursive /usr/share/clickhouse-test/queries/0_stateless/data_minio/ clickminio/test/
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02366_data.jsonl` -> `clickminio/test/02366_data.jsonl`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02876.parquet` -> `clickminio/test/02876.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.parquet` -> `clickminio/test/02731.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.arrow` -> `clickminio/test/02731.arrow`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive1.tar` -> `clickminio/test/03036_archive1.tar`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive1.zip` -> `clickminio/test/03036_archive1.zip`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive2.tar` -> `clickminio/test/03036_archive2.tar`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive2.zip` -> `clickminio/test/03036_archive2.zip`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive3.tar.gz` -> `clickminio/test/03036_archive3.tar.gz`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_compressed_file_archive.zip` -> `clickminio/test/03036_compressed_file_archive.zip`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_json_archive.zip` -> `clickminio/test/03036_json_archive.zip`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/a.tsv` -> `clickminio/test/a.tsv`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/b.tsv` -> `clickminio/test/b.tsv`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/c.tsv` -> `clickminio/test/c.tsv`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/column1=Gordon/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/column1=Gordon/sample.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/column1=Schmidt/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/column1=Schmidt/sample.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/sample.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/non_existing_column=Elizabeth/sample.parquet` -> `clickminio/test/hive_partitioning/non_existing_column=Elizabeth/sample.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/json_data` -> `clickminio/test/json_data`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/tsv_with_header.tsv` -> `clickminio/test/tsv_with_header.tsv`
Total: 5.42 MiB, Transferred: 5.42 MiB, Speed: 119.39 MiB/s
+ setup_aws_credentials
+ local minio_root_user=clickhouse
+ local minio_root_password=clickhouse
+ mkdir -p /root/.aws
+ cat
+ ./setup_hdfs_minicluster.sh
+ ls -lha
total 125M
drwxr-xr-x 1 root root 4.0K Jun 25 16:07 .
drwxr-xr-x 1 root root 4.0K Jun 25 16:07 ..
-rw-rw-r-- 1 1000 1000 119 Jun 25 16:02 analyzer_tech_debt.txt
-rw-rw-r-- 1 root root 2.4K Jan 31 16:43 attach_gdb.lib
-rw-r--r-- 1 root root 1.3K Jun 25 16:07 __azurite_db_blob_extent__.json
-rw-r--r-- 1 root root 3.9K Jun 25 16:07 __azurite_db_blob__.json
-rw-r--r-- 1 root root 1.4K Jun 25 16:07 azurite_log
lrwxrwxrwx 1 root root 7 Sep 11 2024 bin -> usr/bin
drwxr-xr-x 2 root root 4.0K Jun 25 16:07 __blobstorage__
drwxr-xr-x 2 root root 4.0K Apr 18 2022 boot
-rw-rw-r-- 1 1000 1000 292 Jun 25 16:02 broken_tests.json
drwxr-xr-x 14 root root 3.8K Jun 25 16:06 dev
-rwxr-xr-x 1 root root 0 Jun 25 16:06 .dockerenv
drwxr-xr-x 1 root root 4.0K Jun 25 16:07 etc
drwxr-xr-x 10 1000 1000 4.0K Jun 15 2021 hadoop-3.3.1
drwxr-xr-x 2 root root 4.0K Apr 18 2022 home
lrwxrwxrwx 1 root root 7 Sep 11 2024 lib -> usr/lib
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib32 -> usr/lib32
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib64 -> usr/lib64
lrwxrwxrwx 1 root root 10 Sep 11 2024 libx32 -> usr/libx32
-rwxr-xr-x 1 root root 26M Jan 31 17:05 mc
drwxr-xr-x 2 root root 4.0K Sep 11 2024 media
-rwxr-xr-x 1 root root 99M Jan 31 17:03 minio
drwxr-xr-x 4 root root 4.0K Jun 25 16:07 minio_data
drwxr-xr-x 2 root root 4.0K Sep 11 2024 mnt
drwxr-xr-x 1 root root 4.0K Jan 31 16:44 opt
-rw-r--r-- 1 root root 0 Feb 14 2024 .package-cache-mutate
drwxrwxr-x 2 1000 1000 4.0K Jun 25 16:06 package_folder
dr-xr-xr-x 308 root root 0 Jun 25 16:06 proc
-rwxrwxr-x 1 root root 9.5K Jan 31 16:43 process_functional_tests_result.py
-rw-rw-r-- 1 root root 837 Jan 31 16:43 requirements.txt
drwx------ 1 root root 4.0K Jun 25 16:07 root
drwxr-xr-x 1 root root 4.0K Jun 25 16:07 run
-rwxrwxr-x 1 root root 22K Jan 31 16:43 run.sh
lrwxrwxrwx 1 root root 8 Sep 11 2024 sbin -> usr/sbin
-rwxrwxr-x 1 root root 11K Jan 31 16:43 setup_export_logs.sh
-rwxrwxr-x 1 root root 360 Jan 31 16:43 setup_hdfs_minicluster.sh
-rwxrwxr-x 1 root root 3.4K Jan 31 16:43 setup_minio.sh
drwxr-xr-x 2 root root 4.0K Sep 11 2024 srv
-rw-rw-r-- 1 root root 14K Jan 31 16:43 stress_tests.lib
dr-xr-xr-x 13 root root 0 Jun 25 16:06 sys
drwxrwxr-x 2 1000 1000 4.0K Jun 25 16:06 test_output
drwxrwxrwt 1 root root 4.0K Jan 31 17:03 tmp
drwxr-xr-x 1 root root 4.0K Sep 11 2024 usr
-rw-rw-r-- 1 root root 897 Jan 31 16:43 utils.lib
drwxr-xr-x 1 root root 4.0K Sep 11 2024 var
+ cd hadoop-3.3.1
+ export JAVA_HOME=/usr
+ JAVA_HOME=/usr
+ mkdir -p target/test/data
+ chown clickhouse ./target/test/data
+ nc -z localhost 12222
+ sudo -E -u clickhouse bin/mapred minicluster -format -nomr -nnport 12222
+ sleep 1
+ nc -z localhost 12222
+ sleep 1
+ nc -z localhost 12222
+ lsof -i :12222
COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME
java 425 clickhouse 322u IPv4 24121 0t0 TCP localhost:12222 (LISTEN)
java 425 clickhouse 544u IPv4 35378 0t0 TCP localhost:44698->localhost:12222 (ESTABLISHED)
java 425 clickhouse 545u IPv4 35918 0t0 TCP localhost:12222->localhost:44698 (ESTABLISHED)
+ sleep 5
+ config_logs_export_cluster /etc/clickhouse-server/config.d/system_logs_export.yaml
+ set +x
File /tmp/export-logs-config.sh does not exist, do not setup
+ [[ -n '' ]]
+ export IS_FLAKY_CHECK=0
+ IS_FLAKY_CHECK=0
+ '[' 1 -gt 1 ']'
+ sudo -E -u clickhouse /usr/bin/clickhouse-server --config /etc/clickhouse-server/config.xml --daemon --pid-file /var/run/clickhouse-server/clickhouse-server.pid
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for _ in {1..100}
+ clickhouse-client --query 'SELECT 1'
Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR)
+ sleep 1
127.0.0.1 - - [25/Jun/2025:14:07:42 +0000] "GET /devstoreaccount1/cont?restype=container HTTP/1.1" 404 -
127.0.0.1 - - [25/Jun/2025:14:07:42 +0000] "PUT /devstoreaccount1/cont?restype=container HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:07:42 +0000] "PUT /devstoreaccount1/cont/lpfrgxjyyffbiksjerhethuxoplilzpi HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:07:42 +0000] "GET /devstoreaccount1/cont/lpfrgxjyyffbiksjerhethuxoplilzpi HTTP/1.1" 206 4
127.0.0.1 - - [25/Jun/2025:14:07:42 +0000] "GET /devstoreaccount1/cont/lpfrgxjyyffbiksjerhethuxoplilzpi HTTP/1.1" 206 2
127.0.0.1 - - [25/Jun/2025:14:07:42 +0000] "DELETE /devstoreaccount1/cont/lpfrgxjyyffbiksjerhethuxoplilzpi HTTP/1.1" 202 -
+ for _ in {1..100}
+ clickhouse-client --query 'SELECT 1'
1
+ break
+ setup_logs_replication
+ set +x
File /tmp/export-logs-config.sh does not exist, do not setup
+ attach_gdb_to_clickhouse
++ run_with_retry 5 clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)'
++ [[ ahxB =~ e ]]
++ set_e=false
++ set +e
++ local total_retries=5
++ shift
++ local retry=0
++ '[' 0 -ge 5 ']'
++ clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)'
++ false
++ return
+ IS_ASAN=0
+ [[ 0 = \1 ]]
++ kill -l SIGRTMIN
+ RTMIN=34
+ echo '
set follow-fork-mode parent
handle SIGHUP nostop noprint pass
handle SIGINT nostop noprint pass
handle SIGQUIT nostop noprint pass
handle SIGPIPE nostop noprint pass
handle SIGTERM nostop noprint pass
handle SIGUSR1 nostop noprint pass
handle SIGUSR2 nostop noprint pass
handle SIG34 nostop noprint pass
info signals
continue
backtrace full
info registers
p top' 1 KiB of the 'stack:
p/x *(uint64_t[128]*)$sp
maintenance info sections
thread apply all backtrace full
disassemble /s
up
disassemble /s
up
disassemble /s
p "done"
detach
quit
'
+ sleep 5
+ ts '%Y-%m-%d %H:%M:%S'
++ cat /var/run/clickhouse-server/clickhouse-server.pid
+ gdb -batch -command script.gdb -p 615
+ run_with_retry 60 clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\'''
+ [[ aehxB =~ e ]]
+ set_e=true
+ set +e
+ local total_retries=60
+ shift
+ local retry=0
+ '[' 0 -ge 60 ']'
+ clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\'''
Connected to clickhouse-server after attaching gdb
+ true
+ set -e
+ return
+ clickhouse-client --query 'CREATE TABLE minio_audit_logs
(
log String,
event_time DateTime64(9) MATERIALIZED parseDateTime64BestEffortOrZero(trim(BOTH '\''"'\'' FROM JSONExtractRaw(log, '\''time'\'')), 9, '\''UTC'\'')
)
ENGINE = MergeTree
ORDER BY tuple()'
+ clickhouse-client --query 'CREATE TABLE minio_server_logs
(
log String,
event_time DateTime64(9) MATERIALIZED parseDateTime64BestEffortOrZero(trim(BOTH '\''"'\'' FROM JSONExtractRaw(log, '\''time'\'')), 9, '\''UTC'\'')
)
ENGINE = MergeTree
ORDER BY tuple()'
+ ./mc admin config set clickminio logger_webhook:ch_server_webhook 'endpoint=http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_server_logs%20FORMAT%20LineAsString' queue_size=1000000 batch_size=500
Successfully applied new settings.
+ ./mc admin config set clickminio audit_webhook:ch_audit_webhook 'endpoint=http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString' queue_size=1000000 batch_size=500
Successfully applied new settings.
+ max_retries=100
+ retry=1
+ '[' 1 -le 100 ']'
+ echo 'clickminio restart attempt 1:'
clickminio restart attempt 1:
++ ./mc admin service restart clickminio --wait --json
++ jq -r .status
INFO: Restarting on service signal
MinIO Object Storage Server
Copyright: 2015-2025 MinIO, Inc.
License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html
Version: RELEASE.2024-08-03T04-33-23Z (go1.22.5 linux/amd64)
API: http://172.17.0.2:11111 http://127.0.0.1:11111
WebUI: http://172.17.0.2:41029 http://127.0.0.1:41029
Docs: https://min.io/docs/minio/linux/index.html
Output of restart status: success
success
Restarted clickminio successfully.
+ output='success
success'
+ echo 'Output of restart status: success
success'
+ expected_output='success
success'
+ '[' 'success
success' = 'success
success' ']'
+ echo 'Restarted clickminio successfully.'
+ break
+ '[' 1 -gt 100 ']'
+ MC_ADMIN_PID=1499
+ ./mc admin trace clickminio
+ export -f run_tests
+ '[' 1 -gt 1 ']'
+ run_tests
+ set -x
+ read -ra ADDITIONAL_OPTIONS
+ HIGH_LEVEL_COVERAGE=YES
+ '[' 1 -gt 1 ']'
+ [[ -n '' ]]
+ [[ -n '' ]]
+ [[ 0 -eq 1 ]]
+ [[ '' -eq 1 ]]
+ [[ 0 -eq 1 ]]
++ clickhouse-client --query 'SELECT value LIKE '\''%SANITIZE_COVERAGE%'\'' FROM system.build_options WHERE name = '\''CXX_FLAGS'\'''
+ [[ 1 == 0 ]]
+ ADDITIONAL_OPTIONS+=('--jobs')
+ ADDITIONAL_OPTIONS+=('8')
+ [[ -n 0 ]]
+ [[ -n 2 ]]
+ ADDITIONAL_OPTIONS+=('--run-by-hash-num')
+ ADDITIONAL_OPTIONS+=("$RUN_BY_HASH_NUM")
+ ADDITIONAL_OPTIONS+=('--run-by-hash-total')
+ ADDITIONAL_OPTIONS+=("$RUN_BY_HASH_TOTAL")
+ HIGH_LEVEL_COVERAGE=NO
+ [[ -n '' ]]
+ [[ NO = \Y\E\S ]]
+ ADDITIONAL_OPTIONS+=('--report-logs-stats')
+ try_run_with_retry 10 clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')'
+ local total_retries=10
+ shift
+ fn_exists run_with_retry
+ declare -F run_with_retry
+ run_with_retry 10 clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')'
+ [[ aehxB =~ e ]]
+ set_e=true
+ set +e
+ local total_retries=10
+ shift
+ local retry=0
+ '[' 0 -ge 10 ']'
+ clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')'
+ true
+ set -e
+ return
+ set +e
+ TEST_ARGS=(--testname --shard --zookeeper --check-zookeeper-session --hung-check --print-time --no-drop-if-fail --capture-client-stacktrace --test-runs "$NUM_TRIES" "${ADDITIONAL_OPTIONS[@]}")
+ clickhouse-test --testname --shard --zookeeper --check-zookeeper-session --hung-check --print-time --no-drop-if-fail --capture-client-stacktrace --test-runs 1 --hung-check --print-time --jobs 8 --run-by-hash-num 0 --run-by-hash-total 2 --report-logs-stats
+ ts '%Y-%m-%d %H:%M:%S'
+ tee -a test_output/test_result.txt
2025-06-25 16:07:54 Using queries from '/usr/share/clickhouse-test/queries' directory
2025-06-25 16:07:54 Connecting to ClickHouse server... OK
2025-06-25 16:07:54 Connected to server 24.8.14.10505.altinitytest @ 9c87a1767af23bdd3d0b18ad701b2f0be92808e3 HEAD
2025-06-25 16:07:54 Found 3250 parallel tests and 281 sequential tests
2025-06-25 16:07:54 Running about 406 stateless tests (Process-7).
2025-06-25 16:07:54 01359_geodistance_loop: [ OK ] 0.22 sec.
2025-06-25 16:07:54 Running about 406 stateless tests (Process-4).
2025-06-25 16:07:54 02969_analyzer_eliminate_injective_functions: [ OK ] 0.32 sec.
2025-06-25 16:07:54 Running about 406 stateless tests (Process-10).
2025-06-25 16:07:54 01134_max_rows_to_group_by: [ OK ] 0.32 sec.
2025-06-25 16:07:54 Running about 406 stateless tests (Process-3).
2025-06-25 16:07:54 01425_default_value_of_type_name: [ OK ] 0.33 sec.
2025-06-25 16:07:54 Running about 406 stateless tests (Process-9).
2025-06-25 16:07:54 01700_system_zookeeper_path_in: [ OK ] 0.32 sec.
2025-06-25 16:07:54 Running about 406 stateless tests (Process-8).
2025-06-25 16:07:54 02876_s3_cluster_schema_inference_names_with_spaces: [ OK ] 0.32 sec.
2025-06-25 16:07:54 Running about 406 stateless tests (Process-5).
2025-06-25 16:07:54 02312_parquet_orc_arrow_names_tuples: [ OK ] 0.37 sec.
2025-06-25 16:07:54 Running about 406 stateless tests (Process-6).
2025-06-25 16:07:54 00063_check_query: [ OK ] 0.37 sec.
2025-06-25 16:07:55 01014_function_repeat_corner_cases: [ OK ] 0.27 sec.
2025-06-25 16:07:55 00854_multiple_join_asterisks: [ OK ] 0.27 sec.
2025-06-25 16:07:55 01473_system_events_zeroes: [ OK ] 0.22 sec.
2025-06-25 16:07:55 02891_alter_update_adaptive_granularity: [ OK ] 0.32 sec.
2025-06-25 16:07:55 00372_cors_header: [ OK ] 0.42 sec.
2025-06-25 16:07:55 02734_optimize_group_by: [ OK ] 0.27 sec.
2025-06-25 16:07:55 01020_function_array_compact: [ OK ] 0.32 sec.
2025-06-25 16:07:55 00739_array_element_nullable_string_mattrobenolt: [ OK ] 0.27 sec.
2025-06-25 16:07:55 02722_matcher_join_use_nulls: [ OK ] 0.62 sec.
2025-06-25 16:07:55 02679_query_parameters_dangling_pointer: [ OK ] 0.27 sec.
2025-06-25 16:07:55 02539_vertical_merge_compact_parts: [ OK ] 0.57 sec.
2025-06-25 16:07:55 02160_h3_hex_area_Km2: [ OK ] 0.32 sec.
2025-06-25 16:07:55 02337_check_translate_qualified_names_matcher: [ OK ] 0.27 sec.
2025-06-25 16:07:55 00052_all_left_join: [ OK ] 0.22 sec.
2025-06-25 16:07:55 01783_merge_engine_join_key_condition: [ OK ] 0.37 sec.
2025-06-25 16:07:55 02875_merge_engine_set_index: [ OK ] 1.17 sec.
2025-06-25 16:07:55 02129_add_column_add_ttl: [ OK ] 0.47 sec.
2025-06-25 16:07:56 00752_low_cardinality_lambda_argument: [ OK ] 0.27 sec.
2025-06-25 16:07:56 02179_range_hashed_dictionary_invalid_interval: [ OK ] 0.32 sec.
2025-06-25 16:07:56 01710_projection_in_set: [ OK ] 0.32 sec.
2025-06-25 16:07:56 00814_parsing_ub: [ OK ] 0.27 sec.
2025-06-25 16:07:56 01532_primary_key_without_order_by_zookeeper: [ OK ] 0.52 sec.
2025-06-25 16:07:56 03240_insert_select_named_tuple: [ OK ] 0.42 sec.
2025-06-25 16:07:56 01825_new_type_json_parallel_insert: [ OK ] 0.37 sec.
2025-06-25 16:07:56 02915_analyzer_fuzz_1: [ OK ] 0.27 sec.
2025-06-25 16:07:56 03246_json_tuple_decompress_race: [ OK ] 0.42 sec.
2025-06-25 16:07:56 00252_shard_global_in_aggregate_function: [ OK ] 0.32 sec.
2025-06-25 16:07:56 02192_comment: [ OK ] 0.22 sec.
2025-06-25 16:07:56 03325_distributed_join_json_array_subcolumns: [ OK ] 0.27 sec.
2025-06-25 16:07:56 00628_in_lambda_on_merge_table_bug: [ OK ] 0.32 sec.
2025-06-25 16:07:56 01600_min_max_compress_block_size: [ OK ] 0.27 sec.
2025-06-25 16:07:56 02177_sum_if_not_found: [ OK ] 0.32 sec.
2025-06-25 16:07:56 02165_h3_num_hexagons: [ OK ] 0.27 sec.
2025-06-25 16:07:57 00354_host_command_line_option: [ OK ] 1.12 sec.
2025-06-25 16:07:57 00492_drop_temporary_table: [ OK ] 0.27 sec.
2025-06-25 16:07:57 02815_fix_not_found_constants_col_in_block: [ OK ] 0.27 sec.
2025-06-25 16:07:57 02902_topKGeneric_deserialization_memory: [ OK ] 0.27 sec.
2025-06-25 16:07:57 02243_ipv6_long_parsing: [ OK ] 0.22 sec.
2025-06-25 16:07:57 03032_rmt_create_columns_from_replica: [ OK ] 0.22 sec.
2025-06-25 16:07:57 01505_log_distributed_deadlock: [ OK ] 0.27 sec.
2025-06-25 16:07:57 01319_query_formatting_in_server_log: [ OK ] 0.42 sec.
2025-06-25 16:07:57 01801_s3_cluster_count: [ OK ] 0.32 sec.
2025-06-25 16:07:57 02354_vector_search_detach_attach: [ OK ] 0.27 sec.
2025-06-25 16:07:57 01603_remove_column_ttl: [ OK ] 0.22 sec.
2025-06-25 16:07:58 02900_clickhouse_local_drop_current_database: [ OK ] 0.57 sec.
2025-06-25 16:07:58 00999_test_skip_indices_with_alter_and_merge: [ OK ] 0.27 sec.
2025-06-25 16:07:58 02426_pod_array_overflow_3: [ OK ] 0.22 sec.
2025-06-25 16:07:58 00308_write_buffer_valid_utf8: [ OK ] 0.22 sec.
2025-06-25 16:07:58 03105_table_aliases_in_mv: [ OK ] 0.27 sec.
2025-06-25 16:07:58 03217_fliter_pushdown_no_keys: [ OK ] 0.27 sec.
2025-06-25 16:07:58 01825_type_json_15: [ OK ] 1.88 sec.
2025-06-25 16:07:58 03073_analyzer_alias_as_column_name: [ OK ] 0.22 sec.
2025-06-25 16:07:58 02125_lz4_compression_bug_TSKV: [ OK ] 3.99 sec.
2025-06-25 16:07:59 02797_range_nullable: [ OK ] 0.37 sec.
2025-06-25 16:07:59 01550_type_map_formats_input: [ OK ] 2.97 sec.
2025-06-25 16:07:59 01274_alter_rename_column_distributed: [ OK ] 0.32 sec.
2025-06-25 16:07:59 01520_client_print_query_id: [ OK ] 0.67 sec.
2025-06-25 16:07:59 00593_union_all_assert_columns_removed: [ OK ] 0.27 sec.
2025-06-25 16:07:59 02493_numeric_literals_with_underscores: [ OK ] 0.92 sec.
2025-06-25 16:07:59 02806_cte_block_cannot_be_empty: [ OK ] 0.27 sec.
2025-06-25 16:07:59 02581_share_big_sets_between_mutation_tasks_with_storage_set: [ OK ] 1.47 sec.
2025-06-25 16:07:59 00916_join_using_duplicate_columns: [ OK ] 0.37 sec.
2025-06-25 16:07:59 01661_test_toDayOfWeek_mysql_compatibility: [ OK ] 0.22 sec.
2025-06-25 16:07:59 00937_ipv4_cidr_range: [ OK ] 0.32 sec.
2025-06-25 16:07:59 02932_idna: [ OK ] 0.67 sec.
2025-06-25 16:08:00 00969_columns_clause: [ OK ] 0.37 sec.
2025-06-25 16:08:00 02131_used_row_policies_in_query_log: [ OK ] 0.52 sec.
2025-06-25 16:08:00 02352_grouby_shadows_arg: [ OK ] 0.32 sec.
2025-06-25 16:08:00 01069_materialized_view_alter_target_table: [ OK ] 0.27 sec.
2025-06-25 16:08:00 02771_tsv_csv_custom_skip_trailing_empty_lines: [ OK ] 0.37 sec.
2025-06-25 16:08:00 00556_array_intersect: [ OK ] 0.32 sec.
2025-06-25 16:08:00 02963_remote_read_small_buffer_size_bug: [ OK ] 3.88 sec.
2025-06-25 16:08:00 03060_analyzer_regular_view_alias: [ OK ] 0.27 sec.
2025-06-25 16:08:00 02559_multiple_read_steps_in_prewhere_missing_columns_2: [ OK ] 0.32 sec.
2025-06-25 16:08:00 02364_dictionary_datetime_64_attribute_crash: [ OK ] 0.27 sec.
2025-06-25 16:08:00 01650_expressions_merge_bug: [ OK ] 0.22 sec.
2025-06-25 16:08:00 03033_create_as_copies_comment: [ OK ] 0.27 sec.
2025-06-25 16:08:01 01825_new_type_json_in_array: [ OK ] 0.32 sec.
2025-06-25 16:08:01 02864_statistics_delayed_materialization_in_merge: [ OK ] 0.37 sec.
2025-06-25 16:08:01 02922_respect_nulls_Nullable: [ OK ] 0.32 sec.
2025-06-25 16:08:01 01427_pk_and_expression_with_different_type: [ OK ] 0.27 sec.
2025-06-25 16:08:01 03290_limit_by_segv: [ OK ] 0.27 sec.
2025-06-25 16:08:01 01881_join_on_conditions_hash: [ OK ] 1.53 sec.
2025-06-25 16:08:01 02594_msgpack_more_types: [ OK ] 0.77 sec.
2025-06-25 16:08:02 00700_decimal_aggregates: [ OK ] 0.97 sec.
2025-06-25 16:08:02 00055_join_two_numbers: [ OK ] 0.22 sec.
2025-06-25 16:08:02 01675_distributed_bytes_to_delay_insert: [ OK ] 4.78 sec.
2025-06-25 16:08:02 01593_insert_settings: [ OK ] 0.42 sec.
2025-06-25 16:08:02 03003_enum_and_string_compatible: [ OK ] 0.22 sec.
2025-06-25 16:08:02 01490_nullable_string_to_enum: [ OK ] 0.27 sec.
2025-06-25 16:08:02 01071_prohibition_secondary_index_with_old_format_merge_tree: [ OK ] 0.27 sec.
2025-06-25 16:08:03 03134_positional_arguments: [ OK ] 1.67 sec.
2025-06-25 16:08:03 02466_distributed_query_profiler: [ OK ] 1.17 sec.
2025-06-25 16:08:03 01404_roundUpToPowerOfTwoOrZero_safety: [ OK ] 0.22 sec.
2025-06-25 16:08:03 02668_parse_datetime_in_joda_syntax: [ OK ] 0.87 sec.
2025-06-25 16:08:03 02122_parallel_formatting_RowBinaryWithNames: [ OK ] 1.52 sec.
2025-06-25 16:08:04 00662_array_has_nullable: [ OK ] 0.42 sec.
2025-06-25 16:08:04 02535_ip_parser_not_whole: [ OK ] 0.23 sec.
2025-06-25 16:08:04 02461_welch_t_test_fuzz: [ OK ] 0.22 sec.
2025-06-25 16:08:04 02888_obsolete_settings: [ OK ] 0.32 sec.
2025-06-25 16:08:04 02876_yyyymmddtodate: [ OK ] 0.82 sec.
2025-06-25 16:08:04 01097_one_more_range_reader_test_wide_part: [ OK ] 0.32 sec.
2025-06-25 16:08:05 01053_drop_database_mat_view: [ OK ] 0.32 sec.
2025-06-25 16:08:05 02266_auto_add_nullable: [ OK ] 0.33 sec.
2025-06-25 16:08:05 01926_date_date_time_supertype: [ OK ] 0.32 sec.
2025-06-25 16:08:05 01083_window_view_select: [ OK ] 2.12 sec.
2025-06-25 16:08:05 00239_type_conversion_in_in: [ OK ] 0.27 sec.
2025-06-25 16:08:06 02723_param_exception_message_context: [ OK ] 0.72 sec.
2025-06-25 16:08:06 02482_insert_into_dist_race: [ OK ] 0.32 sec.
2025-06-25 16:08:06 03002_modify_query_cte: [ OK ] 0.22 sec.
2025-06-25 16:08:06 02863_ignore_foreign_keys_in_tables_definition: [ OK ] 0.22 sec.
2025-06-25 16:08:06 02962_parallel_window_functions_different_partitioning: [ OK ] 0.27 sec.
2025-06-25 16:08:06 02025_nested_func_for_if_combinator: [ OK ] 0.37 sec.
2025-06-25 16:08:06 02911_system_symbols: [ OK ] 0.57 sec.
2025-06-25 16:08:06 00379_system_processes_port: [ OK ] 0.47 sec.
2025-06-25 16:08:06 03054_analyzer_join_alias: [ OK ] 0.22 sec.
2025-06-25 16:08:06 02006_client_test_hint_error_name: [ OK ] 0.27 sec.
2025-06-25 16:08:07 02515_tuple_lambda_parsing: [ OK ] 0.22 sec.
2025-06-25 16:08:07 01548_uncomparable_columns_in_keys: [ OK ] 0.27 sec.
2025-06-25 16:08:08 02815_join_algorithm_setting: [ OK ] 0.82 sec.
2025-06-25 16:08:08 02129_window_functions_disable_optimizations: [ OK ] 0.27 sec.
2025-06-25 16:08:08 01273_arrow_nested_arrays_load: [ OK ] 1.82 sec.
2025-06-25 16:08:08 00421_storage_merge__table_index: [ OK ] 9.64 sec.
2025-06-25 16:08:08 00653_monotonic_integer_cast: [ OK ] 0.27 sec.
2025-06-25 16:08:08 02003_memory_limit_in_client: [ OK ] 4.88 sec.
2025-06-25 16:08:08 01592_length_map: [ OK ] 0.27 sec.
2025-06-25 16:08:09 02969_auto_format_detection: [ OK ] 9.10 sec.
2025-06-25 16:08:09 01825_type_json_4: [ OK ] 2.12 sec.
2025-06-25 16:08:09 03034_dynamic_conversions: [ OK ] 0.47 sec.
2025-06-25 16:08:09 01000_unneeded_substitutions_client: [ OK ] 0.67 sec.
2025-06-25 16:08:09 02791_final_block_structure_mismatch_bug: [ OK ] 0.52 sec.
2025-06-25 16:08:09 01822_short_circuit: [ OK ] 0.72 sec.
2025-06-25 16:08:09 00195_shard_union_all_and_global_in: [ OK ] 0.32 sec.
2025-06-25 16:08:09 00621_regression_for_in_operator: [ OK ] 0.37 sec.
2025-06-25 16:08:10 00726_length_aliases: [ OK ] 0.22 sec.
2025-06-25 16:08:10 02966_nested_offsets_subcolumn: [ OK ] 0.62 sec.
2025-06-25 16:08:10 02210_processors_profile_log: [ OK ] 1.42 sec.
2025-06-25 16:08:10 03222_datetime64_small_value_const: [ OK ] 0.53 sec.
2025-06-25 16:08:10 01497_extract_all_groups_empty_match: [ OK ] 0.27 sec.
2025-06-25 16:08:10 01246_extractAllGroupsVertical: [ OK ] 0.42 sec.
2025-06-25 16:08:10 02900_window_function_with_sparse_column: [ OK ] 0.32 sec.
2025-06-25 16:08:10 03093_with_fill_support_constant_expression: [ OK ] 0.22 sec.
2025-06-25 16:08:10 01073_crlf_end_of_line: [ OK ] 0.27 sec.
2025-06-25 16:08:10 03079_analyzer_numeric_literals_as_column_names: [ OK ] 0.27 sec.
2025-06-25 16:08:11 00392_enum_nested_alter: [ OK ] 0.47 sec.
2025-06-25 16:08:11 02751_query_log_test_partitions: [ OK ] 0.47 sec.
2025-06-25 16:08:13 00443_optimize_final_vertical_merge: [ OK ] 4.68 sec.
2025-06-25 16:08:13 02221_parallel_replicas_bug: [ OK ] 1.62 sec.
2025-06-25 16:08:13 00353_join_by_tuple: [ OK ] 0.22 sec.
2025-06-25 16:08:13 03171_direct_dict_short_circuit_bug: [ OK ] 0.32 sec.
2025-06-25 16:08:14 01358_mutation_delete_null_rows: [ OK ] 0.37 sec.
2025-06-25 16:08:14 01268_mergine_sorted_limit: [ OK ] 0.32 sec.
2025-06-25 16:08:14 02053_INSERT_SELECT_MATERIALIZED: [ OK ] 0.27 sec.
2025-06-25 16:08:14 03039_recursive_cte_postgres_5: [ OK ] 0.42 sec.
2025-06-25 16:08:15 00457_log_tinylog_stripelog_nullable: [ OK ] 0.47 sec.
2025-06-25 16:08:15 02741_hashed_dictionary_load_factor: [ OK ] 0.72 sec.
2025-06-25 16:08:15 02012_sha512_fixedstring: [ OK ] 0.27 sec.
2025-06-25 16:08:15 01655_agg_if_nullable: [ OK ] 0.27 sec.
2025-06-25 16:08:15 01670_distributed_bytes_to_throw_insert: [ OK ] 0.27 sec.
2025-06-25 16:08:15 03208_array_of_json_read_subcolumns_2_memory: [ SKIPPED ] 0.00 sec.
2025-06-25 16:08:15 Reason: not running for current build
2025-06-25 16:08:17 01273_arrow_nullable_arrays_load: [ OK ] 1.72 sec.
2025-06-25 16:08:17 00082_append_trailing_char_if_absent: [ OK ] 0.27 sec.
2025-06-25 16:08:17 03203_client_benchmark_options: [ OK ] 5.88 sec.
2025-06-25 16:08:17 00426_nulls_sorting: [ OK ] 0.42 sec.
2025-06-25 16:08:17 02244_ip_address_invalid_insert: [ OK ] 0.47 sec.
2025-06-25 16:08:18 01010_pmj_on_disk: [ OK ] 0.32 sec.
2025-06-25 16:08:18 00950_default_prewhere: [ OK ] 0.27 sec.
2025-06-25 16:08:19 01515_logtrace_function: [ OK ] 0.62 sec.
2025-06-25 16:08:19 01273_arrow_arrays_load: [ OK ] 1.82 sec.
2025-06-25 16:08:20 02710_protobuf_ipv4_date32: [ OK ] 0.82 sec.
2025-06-25 16:08:20 01444_create_table_drop_database_race: [ OK ] 10.64 sec.
2025-06-25 16:08:21 01079_new_range_reader_segfault: [ OK ] 0.22 sec.
2025-06-25 16:08:21 02771_skip_empty_files: [ OK ] 1.87 sec.
2025-06-25 16:08:21 02782_avro_decimals: [ OK ] 0.62 sec.
2025-06-25 16:08:21 02096_date_time_1970_saturation: [ OK ] 0.32 sec.
2025-06-25 16:08:22 01085_datetime_arithmetic_preserve_timezone: [ OK ] 0.27 sec.
2025-06-25 16:08:22 02783_parsedatetimebesteffort_syslog: [ OK ] 0.32 sec.
2025-06-25 16:08:22 02456_aggregate_state_conversion: [ OK ] 0.27 sec.
2025-06-25 16:08:22 02725_cnf_large_check: [ OK ] 0.37 sec.
2025-06-25 16:08:22 01273_arrow: [ OK ] 12.50 sec.
2025-06-25 16:08:22 01921_datatype_date32: [ OK ] 0.72 sec.
2025-06-25 16:08:23 02523_range_const_start: [ OK ] 0.27 sec.
2025-06-25 16:08:23 01256_misspell_layout_name_podshumok: [ OK ] 0.22 sec.
2025-06-25 16:08:23 02864_filtered_url_with_globs: [ OK ] 0.27 sec.
2025-06-25 16:08:23 01525_select_with_offset_fetch_clause: [ OK ] 0.27 sec.
2025-06-25 16:08:23 01323_redundant_functions_in_order_by: [ OK ] 0.57 sec.
2025-06-25 16:08:23 00335_bom: [ OK ] 0.57 sec.
2025-06-25 16:08:23 01913_names_of_tuple_literal: [ OK ] 0.27 sec.
2025-06-25 16:08:23 00555_right_join_excessive_rows: [ OK ] 0.22 sec.
2025-06-25 16:08:24 01558_enum_as_num_in_tsv_csv_input: [ OK ] 0.32 sec.
2025-06-25 16:08:24 00652_replicated_mutations_zookeeper: [ OK ] 8.39 sec.
2025-06-25 16:08:24 01825_type_json_3: [ OK ] 0.52 sec.
2025-06-25 16:08:24 01784_parallel_formatting_memory: [ OK ] 0.32 sec.
2025-06-25 16:08:24 00951_ngram_search: [ OK ] 0.77 sec.
2025-06-25 16:08:24 00952_insert_into_distributed_with_materialized_column: [ OK ] 0.47 sec.
2025-06-25 16:08:24 01528_allow_nondeterministic_optimize_skip_unused_shards: [ OK ] 0.27 sec.
2025-06-25 16:08:25 03142_untuple_crash: [ OK ] 0.22 sec.
2025-06-25 16:08:25 01460_line_as_string_format: [ OK ] 5.48 sec.
2025-06-25 16:08:25 03201_avro_negative_block_size_arrays: [ OK ] 0.67 sec.
2025-06-25 16:08:25 02912_group_array_sample: [ OK ] 0.27 sec.
2025-06-25 16:08:25 01301_polygons_within: [ OK ] 0.32 sec.
2025-06-25 16:08:25 02995_index_6: [ SKIPPED ] 0.00 sec.
2025-06-25 16:08:25 Reason: not running for current build
2025-06-25 16:08:26 01710_minmax_count_projection_modify_partition_key: [ OK ] 0.27 sec.
2025-06-25 16:08:26 02122_parallel_formatting_Values: [ OK ] 1.67 sec.
2025-06-25 16:08:26 00552_or_nullable: [ OK ] 0.32 sec.
2025-06-25 16:08:26 03001_block_offset_column_2: [ OK ] 0.32 sec.
2025-06-25 16:08:26 02696_ignore_inacc_tables_mat_view_atttach: [ OK ] 0.32 sec.
2025-06-25 16:08:26 02999_variant_suspicious_types: [ OK ] 0.27 sec.
2025-06-25 16:08:26 00499_json_enum_insert: [ OK ] 0.27 sec.
2025-06-25 16:08:26 03142_skip_ANSI_in_UTF8_compute_width: [ OK ] 0.22 sec.
2025-06-25 16:08:26 02716_int256_arrayfunc: [ OK ] 0.37 sec.
2025-06-25 16:08:27 02787_transform_null: [ OK ] 0.27 sec.
2025-06-25 16:08:27 02883_read_in_reverse_order_virtual_column: [ OK ] 0.47 sec.
2025-06-25 16:08:27 02833_sparse_columns_tuple_function: [ OK ] 0.27 sec.
2025-06-25 16:08:27 03015_with_fill_invalid_expression: [ OK ] 0.27 sec.
2025-06-25 16:08:27 00804_test_alter_compression_codecs: [ OK ] 3.63 sec.
2025-06-25 16:08:28 01445_create_table_as_table_function: [ OK ] 0.97 sec.
2025-06-25 16:08:28 01925_merge_prewhere_table: [ OK ] 0.27 sec.
2025-06-25 16:08:28 02010_lc_native: [ OK ] 1.32 sec.
2025-06-25 16:08:28 00900_orc_arrow_parquet_maps: [ OK ] 3.58 sec.
2025-06-25 16:08:28 00900_null_array_orc_load: [ OK ] 1.52 sec.
2025-06-25 16:08:28 00734_timeslot: [ OK ] 0.27 sec.
2025-06-25 16:08:29 03202_dynamic_null_map_subcolumn: [ OK ] 1.02 sec.
2025-06-25 16:08:29 03164_analyzer_validate_tree_size: [ OK ] 0.42 sec.
2025-06-25 16:08:29 00900_long_parquet: [ OK ] 18.42 sec.
2025-06-25 16:08:29 01526_initial_query_id: [ OK ] 1.22 sec.
2025-06-25 16:08:29 02887_format_readable_timedelta_subseconds: [ OK ] 0.32 sec.
2025-06-25 16:08:29 02267_output_format_prometheus: [ OK ] 0.27 sec.
2025-06-25 16:08:29 02681_aggregation_by_partitions_bug: [ OK ] 0.32 sec.
2025-06-25 16:08:30 02332_dist_insert_send_logs_level: [ OK ] 0.82 sec.
2025-06-25 16:08:30 02383_schema_inference_hints: [ OK ] 0.27 sec.
2025-06-25 16:08:31 01763_long_ttl_group_by: [ OK ] 1.12 sec.
2025-06-25 16:08:31 00394_new_nested_column_keeps_offsets: [ OK ] 0.32 sec.
2025-06-25 16:08:31 02456_alter-nullable-column-bag: [ OK ] 0.27 sec.
2025-06-25 16:08:32 01509_format_raw_blob: [ OK ] 1.22 sec.
2025-06-25 16:08:32 02418_keeper_map_keys_limit: [ OK ] 0.32 sec.
2025-06-25 16:08:33 00950_test_gorilla_codec: [ OK ] 0.37 sec.
2025-06-25 16:08:33 02150_replace_regexp_all_empty_match: [ OK ] 0.27 sec.
2025-06-25 16:08:34 02122_parallel_formatting_Pretty: [ OK ] 3.33 sec.
2025-06-25 16:08:34 01362_year_of_ISO8601_week_modificators_for_formatDateTime: [ OK ] 0.22 sec.
2025-06-25 16:08:35 03036_test_parquet_bloom_filter_push_down: [ OK ] 5.68 sec.
2025-06-25 16:08:35 00160_merge_and_index_in_in: [ OK ] 1.92 sec.
2025-06-25 16:08:35 01523_interval_operator_support_string_literal: [ OK ] 0.32 sec.
2025-06-25 16:08:35 00059_shard_global_in_mergetree: [ OK ] 0.42 sec.
2025-06-25 16:08:36 01230_join_get_truncate: [ OK ] 0.32 sec.
2025-06-25 16:08:36 00386_long_in_pk: [ OK ] 7.84 sec.
2025-06-25 16:08:36 00700_decimal_arithm: [ OK ] 1.47 sec.
2025-06-25 16:08:37 03167_base64_url_functions_sh: [ OK ] 36.61 sec.
2025-06-25 16:08:37 01927_query_views_log_current_database: [ OK ] 0.82 sec.
2025-06-25 16:08:37 01669_test_toYear_mysql_dialect: [ OK ] 0.27 sec.
2025-06-25 16:08:37 00714_alter_uuid: [ OK ] 0.37 sec.
2025-06-25 16:08:37 02458_key_condition_not_like_prefix: [ OK ] 0.37 sec.
2025-06-25 16:08:38 02377_optimize_sorting_by_input_stream_properties: [ OK ] 0.47 sec.
2025-06-25 16:08:38 01101_literal_column_clash: [ OK ] 0.37 sec.
2025-06-25 16:08:38 02972_insert_deduplication_token_hierarchical_inserts_views: [ OK ] 3.58 sec.
2025-06-25 16:08:38 02017_columns_with_dot: [ OK ] 0.37 sec.
2025-06-25 16:08:38 00910_crash_when_distributed_modify_order_by: [ OK ] 0.27 sec.
2025-06-25 16:08:38 02579_parameterized_replace: [ OK ] 0.22 sec.
2025-06-25 16:08:41 01583_parallel_parsing_exception_with_offset: [ OK ] 2.28 sec.
2025-06-25 16:08:41 00688_low_cardinality_in: [ OK ] 0.32 sec.
2025-06-25 16:08:41 03152_dynamic_type_simple: [ OK ] 0.37 sec.
2025-06-25 16:08:42 02366_kql_mvexpand: [ OK ] 0.42 sec.
2025-06-25 16:08:42 03041_dynamic_type_check_table: [ OK ] 6.08 sec.
2025-06-25 16:08:42 01736_null_as_default: [ OK ] 0.27 sec.
2025-06-25 16:08:42 01086_window_view_cleanup: [ OK ] 4.63 sec.
2025-06-25 16:08:42 01710_minmax_count_projection_constant_query: [ OK ] 0.27 sec.
2025-06-25 16:08:43 00564_versioned_collapsing_merge_tree: [ OK ] 4.23 sec.
2025-06-25 16:08:43 02381_join_dup_columns_in_plan: [ OK ] 0.42 sec.
2025-06-25 16:08:43 03135_keeper_client_find_commands: [ OK ] 0.92 sec.
2025-06-25 16:08:43 00287_column_const_with_nan: [ OK ] 0.22 sec.
2025-06-25 16:08:43 01034_move_partition_from_table_zookeeper: [ OK ] 41.57 sec.
2025-06-25 16:08:43 03140_client_subsequent_external_tables: [ OK ] 0.62 sec.
2025-06-25 16:08:43 00553_buff_exists_materlized_column: [ OK ] 0.32 sec.
2025-06-25 16:08:43 01034_prewhere_max_parallel_replicas_distributed: [ OK ] 0.32 sec.
2025-06-25 16:08:43 03171_hashed_dictionary_short_circuit_bug_fix: [ OK ] 0.32 sec.
2025-06-25 16:08:44 02030_function_mapContainsKeyLike: [ OK ] 0.32 sec.
2025-06-25 16:08:44 02886_missed_json_subcolumns: [ OK ] 0.32 sec.
2025-06-25 16:08:44 01802_toDateTime64_large_values: [ OK ] 0.27 sec.
2025-06-25 16:08:44 00800_function_java_hash: [ OK ] 0.32 sec.
2025-06-25 16:08:44 01797_StripeLog_rwlock_ub: [ OK ] 0.27 sec.
2025-06-25 16:08:44 03198_bit_shift_throws_error_for_out_of_bounds: [ OK ] 0.47 sec.
2025-06-25 16:08:44 03039_unknown_identifier_window_function: [ OK ] 0.22 sec.
2025-06-25 16:08:44 00508_materialized_view_to: [ OK ] 0.27 sec.
2025-06-25 16:08:44 01017_mutations_with_nondeterministic_functions_zookeeper: [ OK ] 2.67 sec.
2025-06-25 16:08:45 01671_aggregate_function_group_bitmap_data: [ OK ] 0.27 sec.
2025-06-25 16:08:45 01560_crash_in_agg_empty_arglist: [ OK ] 0.77 sec.
2025-06-25 16:08:45 00172_constexprs_in_set: [ OK ] 0.22 sec.
2025-06-25 16:08:45 01278_format_multiple_queries: [ OK ] 0.47 sec.
2025-06-25 16:08:45 00520_http_nullable: [ OK ] 0.47 sec.
2025-06-25 16:08:45 01788_update_nested_type_subcolumn_check: [ OK ] 0.57 sec.
2025-06-25 16:08:45 01947_mv_subquery: [ OK ] 0.62 sec.
2025-06-25 16:08:46 00097_long_storage_buffer_race_condition: [ OK ] 9.34 sec.
2025-06-25 16:08:46 00829_bitmap_function: [ OK ] 0.82 sec.
2025-06-25 16:08:46 01293_show_settings: [ OK ] 0.12 sec.
2025-06-25 16:08:46 02433_default_expression_operator_in: [ OK ] 0.27 sec.
2025-06-25 16:08:46 02031_format_query_option: [ OK ] 0.47 sec.
2025-06-25 16:08:46 02875_show_functions: [ OK ] 0.97 sec.
2025-06-25 16:08:46 01917_prewhere_column_type: [ OK ] 0.32 sec.
2025-06-25 16:08:46 02971_functions_to_subcolumns_map: [ OK ] 0.27 sec.
2025-06-25 16:08:46 03144_alter_column_and_read: [ OK ] 0.27 sec.
2025-06-25 16:08:46 00612_http_max_query_size_for_distributed: [ OK ] 0.27 sec.
2025-06-25 16:08:46 02319_sql_standard_create_drop_index: [ OK ] 0.37 sec.
2025-06-25 16:08:47 00197_if_fixed_string: [ OK ] 0.27 sec.
2025-06-25 16:08:47 00585_union_all_subquery_aggregation_column_removal: [ OK ] 0.67 sec.
2025-06-25 16:08:47 00612_count: [ OK ] 0.42 sec.
2025-06-25 16:08:47 02361_fsync_profile_events: [ OK ] 1.22 sec.
2025-06-25 16:08:47 00688_low_cardinality_dictionary_deserialization: [ OK ] 0.73 sec.
2025-06-25 16:08:47 02029_quantile_sanitizer: [ OK ] 0.27 sec.
2025-06-25 16:08:47 03210_empty_tuple_lhs_of_in: [ OK ] 0.22 sec.
2025-06-25 16:08:47 01281_parseDateTime64BestEffort: [ OK ] 0.52 sec.
2025-06-25 16:08:48 00098_j_union_all: [ OK ] 0.27 sec.
2025-06-25 16:08:49 03250_SYSTEM_DROP_FORMAT_SCHEMA_CACHE_FOR_Protobuf: [ OK ] 20.88 sec.
2025-06-25 16:08:49 01528_clickhouse_local_prepare_parts: [ OK ] 2.98 sec.
2025-06-25 16:08:50 03142_window_function_limit_by: [ OK ] 0.72 sec.
2025-06-25 16:08:50 00674_join_on_syntax: [ OK ] 2.57 sec.
2025-06-25 16:08:50 00913_many_threads: [ OK ] 2.52 sec.
2025-06-25 16:08:50 02890_untuple_column_names: [ OK ] 0.78 sec.
2025-06-25 16:08:50 00862_decimal_in: [ OK ] 0.37 sec.
2025-06-25 16:08:50 03213_rand_dos: [ OK ] 0.27 sec.
2025-06-25 16:08:50 00069_date_arithmetic: [ OK ] 0.27 sec.
2025-06-25 16:08:50 00957_neighbor: [ OK ] 0.42 sec.
2025-06-25 16:08:51 00098_7_union_all: [ OK ] 0.27 sec.
2025-06-25 16:08:51 01678_great_circle_angle: [ OK ] 0.32 sec.
2025-06-25 16:08:51 00169_join_constant_keys: [ OK ] 0.27 sec.
2025-06-25 16:08:51 02918_gorilla_invalid_file: [ OK ] 0.47 sec.
2025-06-25 16:08:51 02784_projections_read_in_order_bug: [ OK ] 0.32 sec.
2025-06-25 16:08:51 02884_string_distance_function: [ OK ] 0.42 sec.
2025-06-25 16:08:52 02875_parallel_replicas_remote: [ OK ] 0.62 sec.
2025-06-25 16:08:52 01746_extract_text_from_html: [ OK ] 0.32 sec.
2025-06-25 16:08:52 02890_describe_table_options: [ OK ] 0.32 sec.
2025-06-25 16:08:53 01950_kill_large_group_by_query: [ OK ] 1.62 sec.
2025-06-25 16:08:53 02344_distinct_limit_distiributed: [ OK ] 0.72 sec.
2025-06-25 16:08:53 02918_analyzer_to_ast_crash: [ OK ] 0.22 sec.
2025-06-25 16:08:53 02575_merge_prewhere_materialized: [ OK ] 0.27 sec.
2025-06-25 16:08:53 01475_fix_bigint_shift: [ OK ] 0.22 sec.
2025-06-25 16:08:54 02428_index_analysis_with_null_literal: [ OK ] 0.62 sec.
2025-06-25 16:08:54 02493_inconsistent_hex_and_binary_number: [ OK ] 1.72 sec.
2025-06-25 16:08:54 02874_analysis_of_variance_overflow: [ OK ] 0.27 sec.
2025-06-25 16:08:54 00825_protobuf_format_persons: [ OK ] 7.03 sec.
2025-06-25 16:08:55 01072_select_constant_limit: [ OK ] 0.22 sec.
2025-06-25 16:08:55 02394_every_profile_event_must_have_documentation: [ OK ] 0.27 sec.
2025-06-25 16:08:55 01322_cast_keep_nullable: [ OK ] 0.27 sec.
2025-06-25 16:08:55 01358_lc_parquet: [ OK ] 4.38 sec.
2025-06-25 16:08:55 01660_second_extremes_bug: [ OK ] 0.32 sec.
2025-06-25 16:08:55 03048_not_found_column_xxx_in_block: [ OK ] 0.32 sec.
2025-06-25 16:08:55 00999_join_on_expression: [ OK ] 0.42 sec.
2025-06-25 16:08:55 00700_decimal_casts: [ OK ] 0.97 sec.
2025-06-25 16:08:56 01664_decimal_ubsan: [ OK ] 0.27 sec.
2025-06-25 16:08:56 01418_index_analysis_bug: [ OK ] 0.37 sec.
2025-06-25 16:08:56 01785_pmj_lc_bug: [ OK ] 0.32 sec.
2025-06-25 16:08:56 01913_fix_column_transformer_replace_format: [ OK ] 0.22 sec.
2025-06-25 16:08:56 01097_cyclic_defaults: [ OK ] 0.37 sec.
2025-06-25 16:08:56 01871_merge_tree_compile_expressions: [ OK ] 0.67 sec.
2025-06-25 16:08:57 01868_order_by_fill_with_datetime64: [ OK ] 0.32 sec.
2025-06-25 16:08:57 00515_enhanced_time_zones: [ OK ] 0.72 sec.
2025-06-25 16:08:57 02387_parse_date_as_datetime: [ OK ] 0.27 sec.
2025-06-25 16:08:57 03018_analyzer_distributed_query_with_positional_arguments: [ OK ] 0.27 sec.
2025-06-25 16:08:57 02421_new_type_json_async_insert: [ OK ] 2.22 sec.
2025-06-25 16:08:57 01054_random_printable_ascii_ubsan: [ OK ] 1.92 sec.
2025-06-25 16:08:57 01674_unicode_asan: [ OK ] 0.27 sec.
2025-06-25 16:08:58 00516_deduplication_after_drop_partition_zookeeper: [ OK ] 0.47 sec.
2025-06-25 16:08:58 02675_sparse_columns_clear_column: [ OK ] 0.77 sec.
2025-06-25 16:08:58 00688_low_cardinality_syntax: [ OK ] 0.47 sec.
2025-06-25 16:08:59 01528_to_uuid_or_null_or_zero: [ OK ] 0.37 sec.
2025-06-25 16:08:59 00914_replicate: [ OK ] 0.22 sec.
2025-06-25 16:08:59 00974_fix_join_on: [ OK ] 0.47 sec.
2025-06-25 16:08:59 02354_vector_search_default_granularity: [ OK ] 0.27 sec.
2025-06-25 16:09:00 00340_squashing_insert_select: [ OK ] 0.97 sec.
2025-06-25 16:09:00 02417_null_variadic_behaviour: [ OK ] 0.62 sec.
2025-06-25 16:09:01 00328_long_case_construction: [ OK ] 16.70 sec.
2025-06-25 16:09:01 00612_union_query_with_subquery: [ OK ] 0.27 sec.
2025-06-25 16:09:01 02501_analyzer_expired_context_crash_fix: [ OK ] 0.27 sec.
2025-06-25 16:09:01 01552_dict_fixedstring: [ OK ] 0.32 sec.
2025-06-25 16:09:01 02015_async_inserts_4: [ OK ] 3.68 sec.
2025-06-25 16:09:01 02713_array_low_cardinality_string: [ OK ] 0.27 sec.
2025-06-25 16:09:01 02735_array_map_array_of_tuples: [ OK ] 0.32 sec.
2025-06-25 16:09:01 02149_schema_inference_create_table_syntax: [ OK ] 4.18 sec.
2025-06-25 16:09:01 00273_quantiles: [ OK ] 0.47 sec.
2025-06-25 16:09:01 02577_analyzer_array_join_calc_twice: [ OK ] 0.22 sec.
2025-06-25 16:09:02 02784_disable_async_with_dedup_correctly: [ OK ] 2.17 sec.
2025-06-25 16:09:02 01015_empty_in_inner_right_join: [ OK ] 0.47 sec.
2025-06-25 16:09:02 01144_multiword_data_types: [ OK ] 0.27 sec.
2025-06-25 16:09:02 03205_json_syntax: [ OK ] 0.37 sec.
2025-06-25 16:09:02 03156_default_multiquery_split: [ OK ] 0.87 sec.
2025-06-25 16:09:02 00483_reading_from_array_structure: [ OK ] 0.32 sec.
2025-06-25 16:09:02 01509_dictionary_preallocate: [ OK ] 0.72 sec.
2025-06-25 16:09:02 00135_duplicate_group_by_keys_segfault: [ OK ] 0.12 sec.
2025-06-25 16:09:02 01714_alter_drop_version: [ OK ] 0.32 sec.
2025-06-25 16:09:02 01096_block_serialized_state: [ OK ] 0.22 sec.
2025-06-25 16:09:03 02707_analyzer_nested_lambdas_types: [ OK ] 0.32 sec.
2025-06-25 16:09:03 03084_analyzer_join_column_alias: [ OK ] 0.27 sec.
2025-06-25 16:09:03 00209_insert_select_extremes: [ OK ] 0.32 sec.
2025-06-25 16:09:03 02941_variant_type_1: [ OK ] 11.04 sec.
2025-06-25 16:09:03 02992_all_columns_should_have_comment: [ OK ] 0.72 sec.
2025-06-25 16:09:03 00300_csv: [ OK ] 0.27 sec.
2025-06-25 16:09:04 01244_optimize_distributed_group_by_sharding_key: [ OK ] 1.02 sec.
2025-06-25 16:09:04 03198_orc_read_time_zone: [ OK ] 1.37 sec.
2025-06-25 16:09:04 00400_client_external_options: [ OK ] 1.42 sec.
2025-06-25 16:09:05 01518_nullable_aggregate_states2: [ OK ] 1.87 sec.
2025-06-25 16:09:05 02990_arrayFold_nullable_lc: [ OK ] 0.42 sec.
2025-06-25 16:09:05 02274_full_sort_join_nodistinct: [ OK ] 3.43 sec.
2025-06-25 16:09:05 02205_map_populate_series_non_const: [ OK ] 0.67 sec.
2025-06-25 16:09:05 02204_fractional_progress_bar_long: [ SKIPPED ] 0.00 sec.
2025-06-25 16:09:05 Reason: not running for current build
2025-06-25 16:09:05 02154_bitmap_contains: [ OK ] 0.22 sec.
2025-06-25 16:09:05 02931_file_cluster: [ OK ] 0.62 sec.
2025-06-25 16:09:05 01825_type_json_empty_string: [ OK ] 0.27 sec.
2025-06-25 16:09:05 02967_analyzer_fuzz: [ OK ] 0.32 sec.
2025-06-25 16:09:05 01821_join_table_mutation: [ OK ] 0.37 sec.
2025-06-25 16:09:05 01925_date_date_time_comparison: [ OK ] 0.22 sec.
2025-06-25 16:09:06 02783_date_predicate_optimizations: [ OK ] 0.98 sec.
2025-06-25 16:09:06 00447_foreach_modifier: [ OK ] 0.37 sec.
2025-06-25 16:09:06 03031_input_format_allow_errors_num_bad_escape_sequence: [ OK ] 0.22 sec.
2025-06-25 16:09:07 01710_projections_optimize_aggregation_in_order: [ OK ] 3.62 sec.
2025-06-25 16:09:07 02346_into_outfile_and_stdout: [ OK ] 1.99 sec.
2025-06-25 16:09:07 02752_space_function: [ OK ] 0.57 sec.
2025-06-25 16:09:07 03447_grouping_sets_analyzer_const_columns: [ OK ] 0.27 sec.
2025-06-25 16:09:07 01554_row_number_after_cannot_read_all_data: [ OK ] 0.67 sec.
2025-06-25 16:09:07 02428_delete_with_settings: [ OK ] 0.42 sec.
2025-06-25 16:09:07 01116_asof_join_dolbyzerr: [ OK ] 0.27 sec.
2025-06-25 16:09:08 00903_array_with_constant_function: [ OK ] 0.27 sec.
2025-06-25 16:09:08 00192_least_greatest: [ OK ] 0.32 sec.
2025-06-25 16:09:08 01942_dateTimeToSnowflakeID: [ OK ] 0.37 sec.
2025-06-25 16:09:08 03210_nested_short_circuit_functions_bug: [ OK ] 0.27 sec.
2025-06-25 16:09:08 02514_tsv_zero_started_number: [ OK ] 0.22 sec.
2025-06-25 16:09:08 01655_test_isnull_mysql_dialect: [ OK ] 0.22 sec.
2025-06-25 16:09:08 02900_matview_create_to_errors: [ OK ] 0.57 sec.
2025-06-25 16:09:08 01383_log_broken_table: [ OK ] 21.17 sec.
2025-06-25 16:09:09 01586_columns_pruning: [ OK ] 0.37 sec.
2025-06-25 16:09:09 01600_quota_by_forwarded_ip: [ OK ] 0.92 sec.
2025-06-25 16:09:09 01047_no_alias_columns_with_table_aliases: [ OK ] 0.27 sec.
2025-06-25 16:09:09 01509_parallel_quorum_and_merge_long: [ OK ] 4.43 sec.
2025-06-25 16:09:09 02444_async_broken_outdated_part_loading: [ OK ] 4.23 sec.
2025-06-25 16:09:09 02183_combinator_if: [ OK ] 0.52 sec.
2025-06-25 16:09:10 01474_custom_null_tsv: [ OK ] 1.37 sec.
2025-06-25 16:09:10 00672_arrayDistinct: [ OK ] 0.32 sec.
2025-06-25 16:09:10 01799_long_uniq_theta_sketch: [ OK ] 1.42 sec.
2025-06-25 16:09:10 02867_null_lc_in_bug: [ OK ] 0.27 sec.
2025-06-25 16:09:10 03289_explain_syntax_statistics: [ OK ] 0.27 sec.
2025-06-25 16:09:10 00299_stripe_log_multiple_inserts: [ OK ] 0.32 sec.
2025-06-25 16:09:10 01269_create_with_null: [ OK ] 0.27 sec.
2025-06-25 16:09:10 00688_aggregation_retention: [ OK ] 0.32 sec.
2025-06-25 16:09:10 02691_multiple_joins_backtick_identifiers: [ OK ] 0.27 sec.
2025-06-25 16:09:10 03100_analyzer_constants_in_multiif: [ OK ] 0.27 sec.
2025-06-25 16:09:11 02562_with_fill_nullable: [ OK ] 0.27 sec.
2025-06-25 16:09:11 00260_like_and_curly_braces: [ OK ] 0.32 sec.
2025-06-25 16:09:11 00917_multiple_joins_denny_crane: [ OK ] 0.27 sec.
2025-06-25 16:09:11 00805_round_down: [ OK ] 0.47 sec.
2025-06-25 16:09:11 02971_analyzer_remote_id: [ OK ] 0.77 sec.
2025-06-25 16:09:11 02429_low_cardinality_trash: [ OK ] 0.47 sec.
2025-06-25 16:09:11 00041_big_array_join: [ OK ] 0.32 sec.
2025-06-25 16:09:12 01514_empty_buffer_different_types: [ OK ] 0.32 sec.
2025-06-25 16:09:12 01014_format_custom_separated: [ OK ] 2.22 sec.
2025-06-25 16:09:12 00318_pk_tuple_order: [ OK ] 0.52 sec.
2025-06-25 16:09:12 01915_merge_prewhere_virtual_column_rand_chao_wang: [ OK ] 0.32 sec.
2025-06-25 16:09:12 02372_analyzer_join: [ OK ] 3.13 sec.
2025-06-25 16:09:12 01596_setting_limit_offset: [ OK ] 0.37 sec.
2025-06-25 16:09:12 02136_kill_scalar_queries: [ OK ] 1.07 sec.
2025-06-25 16:09:12 02263_format_insert_settings: [ OK ] 2.62 sec.
2025-06-25 16:09:12 00834_not_between: [ OK ] 0.27 sec.
2025-06-25 16:09:12 00104_totals_having_mode: [ OK ] 0.32 sec.
2025-06-25 16:09:12 02114_bool_type: [ OK ] 0.27 sec.
2025-06-25 16:09:12 02380_analyzer_join_sample: [ OK ] 0.32 sec.
2025-06-25 16:09:13 01318_encrypt: [ OK ] 0.67 sec.
2025-06-25 16:09:13 03120_analyzer_param_in_CTE_alias: [ OK ] 0.22 sec.
2025-06-25 16:09:13 00974_full_outer_join: [ OK ] 0.27 sec.
2025-06-25 16:09:13 00431_if_nulls: [ OK ] 0.72 sec.
2025-06-25 16:09:13 01353_low_cardinality_join_types: [ OK ] 0.52 sec.
2025-06-25 16:09:13 02504_disallow_arrayjoin_in_mutations: [ OK ] 0.27 sec.
2025-06-25 16:09:13 01474_decimal_scale_bug: [ OK ] 0.32 sec.
2025-06-25 16:09:13 03217_datetime64_constant_to_ast: [ OK ] 0.27 sec.
2025-06-25 16:09:13 01471_top_k_range_check: [ OK ] 0.27 sec.
2025-06-25 16:09:13 02097_initializeAggregationNullable: [ OK ] 0.27 sec.
2025-06-25 16:09:13 01825_new_type_json_distributed: [ OK ] 0.32 sec.
2025-06-25 16:09:13 02458_datediff_date32: [ OK ] 0.42 sec.
2025-06-25 16:09:13 02995_index_10: [ SKIPPED ] 0.00 sec.
2025-06-25 16:09:13 Reason: not running for current build
2025-06-25 16:09:13 02515_projections_with_totals: [ OK ] 0.27 sec.
2025-06-25 16:09:14 01787_arena_assert_column_nothing: [ OK ] 0.22 sec.
2025-06-25 16:09:14 00737_decimal_group_by: [ OK ] 0.32 sec.
2025-06-25 16:09:14 02675_predicate_push_down_filled_join_fix: [ OK ] 0.37 sec.
2025-06-25 16:09:14 01825_type_json_5: [ OK ] 0.32 sec.
2025-06-25 16:09:14 01550_create_map_type: [ OK ] 0.87 sec.
2025-06-25 16:09:14 02984_form_format: [ OK ] 1.62 sec.
2025-06-25 16:09:14 02115_map_contains_analyzer: [ OK ] 0.27 sec.
2025-06-25 16:09:14 00939_limit_by_offset: [ OK ] 0.27 sec.
2025-06-25 16:09:14 02899_indexing_by_space_filling_curves: [ OK ] 0.47 sec.
2025-06-25 16:09:14 02515_aggregate_functions_statistics: [ OK ] 0.42 sec.
2025-06-25 16:09:15 01083_match_zero_byte: [ OK ] 0.27 sec.
2025-06-25 16:09:15 02481_analyzer_optimize_aggregation_arithmetics: [ OK ] 0.42 sec.
2025-06-25 16:09:15 02989_variant_comparison: [ OK ] 0.47 sec.
2025-06-25 16:09:15 00387_use_client_time_zone: [ OK ] 0.62 sec.
2025-06-25 16:09:15 00960_eval_ml_method_const: [ OK ] 0.27 sec.
2025-06-25 16:09:15 02941_projections_external_aggregation: [ OK ] 0.82 sec.
2025-06-25 16:09:15 03049_unknown_identifier_materialized_column: [ OK ] 0.27 sec.
2025-06-25 16:09:15 01521_format_readable_time_delta2: [ OK ] 0.32 sec.
2025-06-25 16:09:15 01083_cross_to_inner_with_in_bug: [ OK ] 0.32 sec.
2025-06-25 16:09:15 02899_distributed_limit_by: [ OK ] 0.67 sec.
2025-06-25 16:09:16 01421_assert_in_in: [ OK ] 0.27 sec.
2025-06-25 16:09:16 02366_explain_query_tree: [ OK ] 0.32 sec.
2025-06-25 16:09:16 00538_datediff: [ OK ] 0.52 sec.
2025-06-25 16:09:16 03014_msan_parse_date_time: [ OK ] 0.32 sec.
2025-06-25 16:09:16 00262_alter_alias: [ OK ] 0.32 sec.
2025-06-25 16:09:16 01091_insert_with_default_json: [ OK ] 0.32 sec.
2025-06-25 16:09:16 01621_summap_check_types: [ OK ] 0.32 sec.
2025-06-25 16:09:16 03068_analyzer_distributed_join: [ OK ] 0.47 sec.
2025-06-25 16:09:16 00462_json_true_false_literals: [ OK ] 0.22 sec.
2025-06-25 16:09:17 01774_case_sensitive_connection_id: [ OK ] 0.22 sec.
2025-06-25 16:09:17 02575_map_hashing_msan: [ OK ] 0.27 sec.
2025-06-25 16:09:17 02477_analyzer_array_join_with_join: [ OK ] 0.57 sec.
2025-06-25 16:09:17 02130_parse_quoted_null: [ OK ] 3.83 sec.
2025-06-25 16:09:17 00732_base64_functions: [ OK ] 0.37 sec.
2025-06-25 16:09:17 01065_if_not_finite: [ OK ] 0.32 sec.
2025-06-25 16:09:17 02474_fix_function_parser_bug: [ OK ] 0.22 sec.
2025-06-25 16:09:18 02985_minmax_index_aggregate_function: [ OK ] 0.37 sec.
2025-06-25 16:09:18 00608_uniq_array: [ OK ] 0.27 sec.
2025-06-25 16:09:18 02911_analyzer_explain_estimate: [ OK ] 0.22 sec.
2025-06-25 16:09:18 00976_system_stop_ttl_merges: [ OK ] 1.32 sec.
2025-06-25 16:09:18 02458_insert_select_progress_tcp: [ OK ] 3.03 sec.
2025-06-25 16:09:18 03284_json_object_as_tuple_duplicate_keys: [ OK ] 0.27 sec.
2025-06-25 16:09:19 02720_row_policy_column_with_dots: [ OK ] 0.27 sec.
2025-06-25 16:09:19 00996_limit_with_ties: [ OK ] 0.47 sec.
2025-06-25 16:09:19 00467_qualified_names: [ OK ] 0.37 sec.
2025-06-25 16:09:19 02904_empty_order_by_with_setting_enabled: [ OK ] 1.27 sec.
2025-06-25 16:09:19 02482_execute_functions_before_sorting_bug: [ OK ] 0.27 sec.
2025-06-25 16:09:20 03148_async_queries_in_query_log_errors: [ OK ] 1.87 sec.
2025-06-25 16:09:20 02280_add_query_level_settings: [ OK ] 0.32 sec.
2025-06-25 16:09:20 01502_jemalloc_percpu_arena: [ SKIPPED ] 0.00 sec.
2025-06-25 16:09:20 Reason: not running for current build
2025-06-25 16:09:20 02455_duplicate_column_names_in_schema_inference: [ OK ] 0.27 sec.
2025-06-25 16:09:20 02136_scalar_progress: [ OK ] 0.52 sec.
2025-06-25 16:09:21 02454_create_table_with_custom_disk: [ OK ] 0.27 sec.
2025-06-25 16:09:21 03167_fancy_quotes_off_by_one: [ OK ] 0.22 sec.
2025-06-25 16:09:21 02910_bad_logs_level_in_local: [ OK ] 0.22 sec.
2025-06-25 16:09:22 02539_settings_alias: [ OK ] 2.42 sec.
2025-06-25 16:09:22 01691_parser_data_type_exponential: [ OK ] 2.32 sec.
2025-06-25 16:09:23 03215_varian_as_common_type_integers: [ OK ] 0.27 sec.
2025-06-25 16:09:23 00875_join_right_nulls: [ OK ] 0.37 sec.
2025-06-25 16:09:23 01796_Log_rwlock_ub: [ OK ] 0.27 sec.
2025-06-25 16:09:24 02344_describe_cache: [ OK ] 1.12 sec.
2025-06-25 16:09:25 02353_compression_level: [ OK ] 5.98 sec.
2025-06-25 16:09:25 00523_aggregate_functions_in_group_array: [ OK ] 0.22 sec.
2025-06-25 16:09:25 01666_merge_tree_max_query_limit: [ OK ] 3.88 sec.
2025-06-25 16:09:25 01165_lost_part_empty_partition: [ OK ] 3.67 sec.
2025-06-25 16:09:25 01070_string_to_h3: [ OK ] 0.27 sec.
2025-06-25 16:09:25 02188_table_function_format: [ OK ] 0.27 sec.
2025-06-25 16:09:26 03226_alter_update_dynamic_json_not_supported: [ OK ] 0.27 sec.
2025-06-25 16:09:26 02952_clickhouse_local_query_parameters_cli: [ OK ] 0.62 sec.
2025-06-25 16:09:26 00647_histogram: [ OK ] 0.27 sec.
2025-06-25 16:09:26 00927_asof_join_noninclusive: [ OK ] 0.42 sec.
2025-06-25 16:09:26 02121_pager: [ OK ] 0.82 sec.
2025-06-25 16:09:27 00687_insert_into_mv: [ OK ] 0.32 sec.
2025-06-25 16:09:27 02701_invalid_having_NOT_AN_AGGREGATE: [ OK ] 0.22 sec.
2025-06-25 16:09:27 02970_visible_width_behavior: [ OK ] 0.32 sec.
2025-06-25 16:09:27 01457_int256_hashing: [ OK ] 0.42 sec.
2025-06-25 16:09:27 01605_skip_idx_compact_parts: [ OK ] 0.32 sec.
2025-06-25 16:09:27 00834_date_datetime_cmp: [ OK ] 0.27 sec.
2025-06-25 16:09:28 01387_clear_column_default_depends: [ OK ] 0.42 sec.
2025-06-25 16:09:28 02151_replace_regexp_all_empty_match_alternative: [ OK ] 0.37 sec.
2025-06-25 16:09:28 01040_dictionary_invalidate_query_switchover_long: [ OK ] 13.40 sec.
2025-06-25 16:09:28 02162_array_first_last_index: [ OK ] 0.32 sec.
2025-06-25 16:09:28 00098_g_union_all: [ OK ] 0.22 sec.
2025-06-25 16:09:28 03092_analyzer_same_table_name_in_different_databases: [ OK ] 0.27 sec.
2025-06-25 16:09:29 00213_multiple_global_in: [ OK ] 0.27 sec.
2025-06-25 16:09:29 01925_map_populate_series_on_map: [ OK ] 0.47 sec.
2025-06-25 16:09:29 00183_skip_unavailable_shards: [ OK ] 24.27 sec.
2025-06-25 16:09:29 03150_grouping_sets_use_nulls_pushdown: [ OK ] 0.32 sec.
2025-06-25 16:09:30 02746_index_analysis_binary_operator_with_null: [ OK ] 0.27 sec.
2025-06-25 16:09:30 03038_recursive_cte_postgres_4: [ OK ] 0.37 sec.
2025-06-25 16:09:30 02311_create_table_with_unknown_format: [ OK ] 0.32 sec.
2025-06-25 16:09:31 01670_test_repeat_mysql_dialect: [ OK ] 0.27 sec.
2025-06-25 16:09:31 02250_ON_CLUSTER_grant: [ OK ] 1.47 sec.
2025-06-25 16:09:31 01710_projection_with_column_transformers: [ OK ] 0.27 sec.
2025-06-25 16:09:31 01720_country_perimeter_and_area: [ OK ] 3.73 sec.
2025-06-25 16:09:32 02494_optimize_group_by_function_keys_and_alias_columns: [ OK ] 0.32 sec.
2025-06-25 16:09:32 03169_cache_complex_dict_short_circuit_bug: [ OK ] 0.32 sec.
2025-06-25 16:09:32 02871_multiple_joins_rewriter_v2_handle_last_table_columns: [ OK ] 0.32 sec.
2025-06-25 16:09:33 02126_fix_filelog: [ OK ] 1.67 sec.
2025-06-25 16:09:33 01271_show_privileges: [ OK ] 0.27 sec.
2025-06-25 16:09:34 02993_lazy_index_loading: [ OK ] 1.07 sec.
2025-06-25 16:09:34 02315_pmj_union_ubsan_35857: [ OK ] 0.27 sec.
2025-06-25 16:09:35 01049_join_low_card_bug_long: [ OK ] 3.78 sec.
2025-06-25 16:09:35 01780_column_sparse_full: [ OK ] 0.82 sec.
2025-06-25 16:09:35 01055_compact_parts_1: [ OK ] 0.32 sec.
2025-06-25 16:09:36 02502_analyzer_insert_select_crash_fix: [ OK ] 0.32 sec.
2025-06-25 16:09:36 01249_flush_interactive: [ OK ] 10.45 sec.
2025-06-25 16:09:36 02990_optimize_uniq_to_count_alias: [ OK ] 0.37 sec.
2025-06-25 16:09:36 01044_h3_edge_angle: [ OK ] 0.22 sec.
2025-06-25 16:09:36 00008_array_join: [ OK ] 0.27 sec.
2025-06-25 16:09:37 01072_drop_temporary_table_with_same_name: [ OK ] 0.27 sec.
2025-06-25 16:09:37 01461_query_start_time_microseconds: [ OK ] 0.52 sec.
2025-06-25 16:09:38 02160_h3_cell_area_m2: [ OK ] 0.37 sec.
2025-06-25 16:09:38 02380_insert_mv_race: [ OK ] 1.62 sec.
2025-06-25 16:09:38 01034_unknown_qualified_column_in_join: [ OK ] 0.37 sec.
2025-06-25 16:09:38 00313_const_totals_extremes: [ OK ] 0.57 sec.
2025-06-25 16:09:38 02901_analyzer_recursive_window: [ OK ] 0.27 sec.
2025-06-25 16:09:39 00460_vertical_and_totals_extremes: [ OK ] 0.27 sec.
2025-06-25 16:09:39 01825_new_type_json_bools: [ OK ] 0.32 sec.
2025-06-25 16:09:39 02357_query_cancellation_race: [ OK ] 6.09 sec.
2025-06-25 16:09:39 00926_adaptive_index_granularity_collapsing_merge_tree: [ OK ] 0.42 sec.
2025-06-25 16:09:39 03208_array_of_json_read_subcolumns_1: [ OK ] 4.38 sec.
2025-06-25 16:09:39 00578_merge_table_and_table_virtual_column: [ OK ] 0.47 sec.
2025-06-25 16:09:39 02540_date_column_consistent_insert_behaviour: [ OK ] 0.62 sec.
2025-06-25 16:09:39 01915_json_extract_raw_string: [ OK ] 0.27 sec.
2025-06-25 16:09:40 01107_join_right_table_totals: [ OK ] 0.62 sec.
2025-06-25 16:09:40 02897_alter_partition_parameters: [ OK ] 0.72 sec.
2025-06-25 16:09:40 02465_limit_trivial_max_rows_to_read: [ OK ] 0.37 sec.
2025-06-25 16:09:40 02233_optimize_aggregation_in_order_prefix: [ OK ] 0.33 sec.
2025-06-25 16:09:40 00446_clear_column_in_partition_concurrent_zookeeper: [ OK ] 12.05 sec.
2025-06-25 16:09:40 00580_consistent_hashing_functions: [ OK ] 0.27 sec.
2025-06-25 16:09:40 00938_fix_rwlock_segfault_long: [ SKIPPED ] 0.00 sec.
2025-06-25 16:09:40 Reason: not running for current build
2025-06-25 16:09:41 03262_column_sizes_with_dynamic_structure: [ OK ] 1.17 sec.
2025-06-25 16:09:41 00717_merge_and_distributed: [ OK ] 0.92 sec.
2025-06-25 16:09:41 02354_with_statement_non_exist_column: [ OK ] 0.22 sec.
2025-06-25 16:09:41 00339_parsing_bad_arrays: [ OK ] 0.57 sec.
2025-06-25 16:09:41 02346_position_countsubstrings_zero_byte: [ OK ] 0.32 sec.
2025-06-25 16:09:41 03040_recursive_cte_postgres_6: [ OK ] 0.57 sec.
2025-06-25 16:09:41 01019_alter_materialized_view_atomic: [ SKIPPED ] 0.00 sec.
2025-06-25 16:09:41 Reason: not running for current build
2025-06-25 16:09:41 02427_mutate_and_zero_copy_replication_zookeeper: [ OK ] 0.37 sec.
2025-06-25 16:09:41 02703_max_local_read_bandwidth: [ OK ] 24.73 sec.
2025-06-25 16:09:42 02481_analyzer_optimize_grouping_sets_keys: [ OK ] 0.27 sec.
2025-06-25 16:09:42 02508_index_analysis_to_date_timezone: [ OK ] 0.27 sec.
2025-06-25 16:09:42 01866_bit_positions_to_array: [ OK ] 0.37 sec.
2025-06-25 16:09:42 02541_empty_function_support_ip: [ OK ] 0.27 sec.
2025-06-25 16:09:42 02788_current_schemas_function: [ OK ] 0.27 sec.
2025-06-25 16:09:42 02382_join_and_filtering_set: [ OK ] 0.42 sec.
2025-06-25 16:09:42 00997_trim: [ OK ] 0.52 sec.
2025-06-25 16:09:42 00820_multiple_joins_subquery_requires_alias: [ OK ] 0.37 sec.
2025-06-25 16:09:42 02122_parallel_formatting_JSONEachRow: [ OK ] 1.92 sec.
2025-06-25 16:09:42 02125_constant_if_condition_and_not_existing_column: [ OK ] 0.32 sec.
2025-06-25 16:09:42 00910_client_window_size_detection: [ OK ] 0.82 sec.
2025-06-25 16:09:43 00825_http_header_query_id: [ OK ] 0.47 sec.
2025-06-25 16:09:43 00181_aggregate_functions_statistics_stable: [ OK ] 0.42 sec.
2025-06-25 16:09:43 00395_nullable: [ OK ] 2.93 sec.
2025-06-25 16:09:43 02313_test_fpc_codec: [ OK ] 0.42 sec.
2025-06-25 16:09:43 01442_date_time_with_params: [ OK ] 0.72 sec.
2025-06-25 16:09:43 00934_is_valid_utf8: [ OK ] 0.87 sec.
2025-06-25 16:09:43 02834_timestamp_function: [ OK ] 0.32 sec.
2025-06-25 16:09:43 02973_parse_crlf_with_tsv_files: [ OK ] 1.07 sec.
2025-06-25 16:09:43 01281_sum_nullable: [ OK ] 0.27 sec.
2025-06-25 16:09:43 03032_save_bad_json_escape_sequences: [ OK ] 0.22 sec.
2025-06-25 16:09:43 00997_extract_all_crash_6627: [ OK ] 0.22 sec.
2025-06-25 16:09:44 02493_analyzer_sum_if_to_count_if: [ OK ] 0.27 sec.
2025-06-25 16:09:44 01633_limit_fuzz: [ OK ] 0.27 sec.
2025-06-25 16:09:44 02489_analyzer_indexes: [ OK ] 0.42 sec.
2025-06-25 16:09:44 01851_s2_to_geo: [ OK ] 0.27 sec.
2025-06-25 16:09:44 00729_prewhere_array_join: [ OK ] 0.42 sec.
2025-06-25 16:09:44 00953_indices_alter_exceptions: [ OK ] 1.47 sec.
2025-06-25 16:09:44 02842_mutations_replace_non_deterministic: [ OK ] 0.97 sec.
2025-06-25 16:09:44 01634_sum_map_nulls: [ OK ] 0.32 sec.
2025-06-25 16:09:44 03251_unaligned_window_function_state: [ OK ] 0.32 sec.
2025-06-25 16:09:44 00880_decimal_in_key: [ OK ] 0.87 sec.
2025-06-25 16:09:45 00037_totals_limit: [ OK ] 0.22 sec.
2025-06-25 16:09:45 03014_group_by_use_nulls_injective_functions_and_analyzer: [ OK ] 0.27 sec.
2025-06-25 16:09:45 02235_check_table_sparse_serialization: [ OK ] 0.27 sec.
2025-06-25 16:09:45 01451_replicated_detach_drop_part_long: [ OK ] 0.52 sec.
2025-06-25 16:09:45 02949_parallel_replicas_in_subquery: [ OK ] 0.42 sec.
2025-06-25 16:09:45 00471_sql_style_quoting: [ OK ] 0.27 sec.
2025-06-25 16:09:45 02416_json_tuple_to_array_schema_inference: [ OK ] 0.22 sec.
2025-06-25 16:09:45 02907_clickhouse_dictionary_bug: [ OK ] 0.67 sec.
2025-06-25 16:09:45 02872_prewhere_filter: [ OK ] 0.27 sec.
2025-06-25 16:09:45 03038_nested_dynamic_merges_compact_horizontal: [ OK ] 2.17 sec.
2025-06-25 16:09:45 03037_dot_product_overflow: [ OK ] 0.27 sec.
2025-06-25 16:09:46 00322_disable_checksumming: [ OK ] 0.52 sec.
2025-06-25 16:09:46 02884_parquet_new_encodings: [ OK ] 0.52 sec.
2025-06-25 16:09:46 02430_initialize_aggregation_with_combinators: [ OK ] 0.22 sec.
2025-06-25 16:09:46 01632_nullable_string_type_convert_to_decimal_type: [ OK ] 0.27 sec.
2025-06-25 16:09:46 03273_dynamic_pretty_json_serialization: [ OK ] 0.22 sec.
2025-06-25 16:09:46 02840_merge__table_or_filter: [ OK ] 0.42 sec.
2025-06-25 16:09:46 01279_empty_external_table: [ OK ] 1.07 sec.
2025-06-25 16:09:46 01278_variance_nonnegative: [ OK ] 0.32 sec.
2025-06-25 16:09:46 03269_partition_key_not_in_set: [ OK ] 0.52 sec.
2025-06-25 16:09:47 00205_emptyscalar_subquery_type_mismatch_bug: [ OK ] 0.28 sec.
2025-06-25 16:09:47 02122_parallel_formatting_TSVWithNames: [ OK ] 1.52 sec.
2025-06-25 16:09:47 01455_nullable_type_with_if_agg_combinator: [ OK ] 0.37 sec.
2025-06-25 16:09:47 02158_proportions_ztest_cmp: [ OK ] 1.22 sec.
2025-06-25 16:09:47 03200_subcolumns_join_use_nulls: [ OK ] 0.27 sec.
2025-06-25 16:09:47 01880_materialized_view_to_table_type_check: [ OK ] 0.37 sec.
2025-06-25 16:09:47 02345_create_table_allow_trailing_comma: [ OK ] 0.32 sec.
2025-06-25 16:09:47 01423_if_nullable_cond: [ OK ] 0.22 sec.
2025-06-25 16:09:47 00698_validate_array_sizes_for_nested: [ OK ] 0.28 sec.
2025-06-25 16:09:48 02370_analyzer_in_function: [ OK ] 0.33 sec.
2025-06-25 16:09:48 01506_buffer_table_alter_block_structure: [ OK ] 0.32 sec.
2025-06-25 16:09:48 02019_multiple_weird_with_fill: [ OK ] 0.22 sec.
2025-06-25 16:09:48 00527_totals_having_nullable: [ OK ] 0.27 sec.
2025-06-25 16:09:48 02477_invalid_reads: [ OK ] 0.77 sec.
2025-06-25 16:09:48 01544_errorCodeToName: [ OK ] 0.27 sec.
2025-06-25 16:09:48 01071_force_optimize_skip_unused_shards: [ OK ] 0.47 sec.
2025-06-25 16:09:49 00821_distributed_storage_with_join_on: [ OK ] 0.32 sec.
2025-06-25 16:09:49 01601_proxy_protocol: [ OK ] 0.47 sec.
2025-06-25 16:09:49 02907_preferred_optimize_projection_name: [ OK ] 4.18 sec.
2025-06-25 16:09:49 00673_subquery_prepared_set_performance: [ OK ] 0.42 sec.
2025-06-25 16:09:49 02516_projections_with_rollup: [ OK ] 1.57 sec.
2025-06-25 16:09:49 00908_long_http_insert: [ OK ] 0.82 sec.
2025-06-25 16:09:50 01079_alter_default_zookeeper_long: [ OK ] 0.52 sec.
2025-06-25 16:09:50 01892_setting_limit_offset_distributed: [ OK ] 0.32 sec.
2025-06-25 16:09:50 00844_join_lightee2: [ OK ] 0.27 sec.
2025-06-25 16:09:50 01599_multiline_input_and_singleline_comments: [ OK ] 1.07 sec.
2025-06-25 16:09:50 02586_generate_random_structure: [ OK ] 0.37 sec.
2025-06-25 16:09:51 02874_array_random_sample: [ OK ] 4.18 sec.
2025-06-25 16:09:51 02943_order_by_all: [ OK ] 0.52 sec.
2025-06-25 16:09:51 02461_prewhere_row_level_policy_lightweight_delete: [ OK ] 1.12 sec.
2025-06-25 16:09:51 01047_simple_aggregate_sizes_of_columns_bug: [ OK ] 1.37 sec.
2025-06-25 16:09:52 02597_projection_materialize_and_replication: [ OK ] 1.32 sec.
2025-06-25 16:09:52 02416_rocksdb_delete_update: [ OK ] 0.42 sec.
2025-06-25 16:09:53 00623_truncate_table: [ OK ] 0.52 sec.
2025-06-25 16:09:53 00925_zookeeper_empty_replicated_merge_tree_optimize_final_long: [ OK ] 2.07 sec.
2025-06-25 16:09:53 02149_schema_inference_formats_with_schema_3: [ OK ] 1.97 sec.
2025-06-25 16:09:53 00231_format_vertical_raw: [ OK ] 0.27 sec.
2025-06-25 16:09:54 00558_parse_floats: [ OK ] 0.27 sec.
2025-06-25 16:09:54 02110_clickhouse_local_custom_tld: [ OK ] 0.57 sec.
2025-06-25 16:09:54 00988_parallel_parts_removal: [ OK ] 1.22 sec.
2025-06-25 16:09:55 02476_fuse_sum_count: [ OK ] 0.42 sec.
2025-06-25 16:09:55 00686_client_exit_code: [ OK ] 0.62 sec.
2025-06-25 16:09:55 01470_columns_transformers2: [ OK ] 0.27 sec.
2025-06-25 16:09:55 02763_row_policy_storage_merge_alias: [ OK ] 0.47 sec.
2025-06-25 16:09:55 03036_parquet_arrow_nullable: [ OK ] 4.43 sec.
2025-06-25 16:09:56 01251_string_comparison: [ OK ] 0.27 sec.
2025-06-25 16:09:56 02100_multiple_hosts_command_line_set_ssl: [ OK ] 31.36 sec.
2025-06-25 16:09:56 02861_join_on_nullsafe_compare: [ OK ] 0.92 sec.
2025-06-25 16:09:56 02354_vector_search_queries: [ OK ] 0.37 sec.
2025-06-25 16:09:56 03203_system_numbers_limit_and_offset_complex: [ OK ] 0.27 sec.
2025-06-25 16:09:56 00159_whitespace_in_columns_list: [ OK ] 0.27 sec.
2025-06-25 16:09:56 01507_transform_null_in: [ OK ] 0.27 sec.
2025-06-25 16:09:56 00964_bloom_index_string_functions: [ OK ] 7.03 sec.
2025-06-25 16:09:56 00534_functions_bad_arguments1: [ SKIPPED ] 0.00 sec.
2025-06-25 16:09:56 Reason: not running for current build
2025-06-25 16:09:56 02833_std_alias: [ OK ] 0.27 sec.
2025-06-25 16:09:56 03069_analyzer_with_alias_in_array_join: [ OK ] 0.22 sec.
2025-06-25 16:09:56 03003_database_filesystem_format_detection: [ OK ] 1.12 sec.
2025-06-25 16:09:57 02426_to_string_nullable_fixedstring: [ OK ] 0.27 sec.
2025-06-25 16:09:57 01795_TinyLog_rwlock_ub: [ OK ] 0.27 sec.
2025-06-25 16:09:57 00263_merge_aggregates_and_overflow: [ OK ] 0.27 sec.
2025-06-25 16:09:57 02128_apply_lambda_parsing: [ OK ] 0.27 sec.
2025-06-25 16:09:57 01616_untuple_access_field: [ OK ] 0.22 sec.
2025-06-25 16:09:57 02310_generate_multi_columns_with_uuid: [ OK ] 0.32 sec.
2025-06-25 16:09:57 01882_scalar_subquery_exception: [ OK ] 0.32 sec.
2025-06-25 16:09:57 02481_async_insert_dedup: [ OK ] 88.29 sec.
2025-06-25 16:09:57 00205_scalar_subqueries: [ OK ] 0.42 sec.
2025-06-25 16:09:57 03002_map_array_functions_with_low_cardinality: [ OK ] 0.22 sec.
2025-06-25 16:09:58 02840_grace_hash_join_structure_mismatch: [ OK ] 0.27 sec.
2025-06-25 16:09:58 02955_analyzer_using_functional_args: [ OK ] 1.17 sec.
2025-06-25 16:09:58 02366_kql_func_ip: [ OK ] 1.27 sec.
2025-06-25 16:09:58 01104_distributed_one_test: [ OK ] 0.37 sec.
2025-06-25 16:09:58 02531_ipv4_arithmetic: [ OK ] 0.22 sec.
2025-06-25 16:09:58 02981_vertical_merges_memory_usage: [ OK ] 1.12 sec.
2025-06-25 16:09:58 00441_nulls_in: [ OK ] 0.42 sec.
2025-06-25 16:09:58 00217_shard_global_subquery_columns_with_same_name: [ OK ] 0.32 sec.
2025-06-25 16:09:58 02999_scalar_subqueries_bug_2: [ OK ] 0.22 sec.
2025-06-25 16:09:58 02383_array_signed_const_positive_index: [ OK ] 0.32 sec.
2025-06-25 16:09:58 01017_uniqCombined_memory_usage: [ OK ] 0.67 sec.
2025-06-25 16:09:58 02013_bloom_filter_hasAll: [ OK ] 0.37 sec.
2025-06-25 16:09:59 01535_decimal_round_scale_overflow_check: [ OK ] 0.22 sec.
2025-06-25 16:09:59 01720_engine_file_empty_if_not_exists: [ OK ] 0.27 sec.
2025-06-25 16:09:59 00712_prewhere_with_final: [ OK ] 0.32 sec.
2025-06-25 16:09:59 01798_having_push_down: [ OK ] 0.32 sec.
2025-06-25 16:09:59 00147_alter_nested_default: [ OK ] 0.37 sec.
2025-06-25 16:09:59 00719_insert_block_without_column: [ OK ] 1.37 sec.
2025-06-25 16:09:59 01042_check_query_and_last_granule_size: [ OK ] 0.42 sec.
2025-06-25 16:09:59 02705_settings_check_changed_flag: [ OK ] 0.37 sec.
2025-06-25 16:09:59 02474_extract_fixedstring_from_json: [ OK ] 0.27 sec.
2025-06-25 16:09:59 02407_array_element_from_map_wrong_type: [ OK ] 0.27 sec.
2025-06-25 16:09:59 03305_fix_kafka_table_with_kw_arguments: [ OK ] 0.22 sec.
2025-06-25 16:09:59 02842_vertical_merge_after_add_drop_column: [ OK ] 0.27 sec.
2025-06-25 16:10:00 02910_nullable_enum_cast: [ OK ] 0.27 sec.
2025-06-25 16:10:00 02149_schema_inference: [ OK ] 11.55 sec.
2025-06-25 16:10:00 01676_range_hashed_dictionary: [ OK ] 0.52 sec.
2025-06-25 16:10:00 02131_skip_index_not_materialized: [ OK ] 0.27 sec.
2025-06-25 16:10:00 00088_distinct_of_arrays_of_strings: [ OK ] 0.22 sec.
2025-06-25 16:10:00 02269_to_start_of_interval_overflow: [ OK ] 0.27 sec.
2025-06-25 16:10:00 01780_column_sparse_tuple: [ OK ] 0.37 sec.
2025-06-25 16:10:00 02915_analyzer_fuzz_2: [ OK ] 0.22 sec.
2025-06-25 16:10:00 03032_variant_bool_number_not_suspicious: [ OK ] 0.27 sec.
2025-06-25 16:10:00 02455_extract_fixed_string_from_nested_json: [ OK ] 0.22 sec.
2025-06-25 16:10:00 03200_memory_engine_alter_dynamic: [ OK ] 0.27 sec.
2025-06-25 16:10:00 01413_if_array_uuid: [ OK ] 0.27 sec.
2025-06-25 16:10:01 02841_join_filter_set_sparse: [ OK ] 0.42 sec.
2025-06-25 16:10:01 02497_if_transform_strings_to_enum: [ OK ] 0.47 sec.
2025-06-25 16:10:01 03062_analyzer_join_engine_missing_column: [ OK ] 0.37 sec.
2025-06-25 16:10:01 02384_analyzer_dict_get_join_get: [ OK ] 0.32 sec.
2025-06-25 16:10:02 02714_async_inserts_empty_data: [ OK ] 1.87 sec.
2025-06-25 16:10:02 01268_mv_scalars: [ OK ] 0.42 sec.
2025-06-25 16:10:02 02229_client_stop_multiquery_in_SIGINT: [ OK ] 8.74 sec.
2025-06-25 16:10:02 00151_tuple_with_array: [ OK ] 0.22 sec.
2025-06-25 16:10:02 01343_min_bytes_to_use_mmap_io: [ OK ] 0.47 sec.
2025-06-25 16:10:02 03020_long_values_pretty_are_not_cut_if_single: [ OK ] 1.62 sec.
2025-06-25 16:10:02 03010_view_prewhere_in: [ OK ] 0.27 sec.
2025-06-25 16:10:02 02122_parallel_formatting_Vertical: [ OK ] 2.07 sec.
2025-06-25 16:10:03 00905_compile_expressions_compare_big_dates: [ OK ] 0.27 sec.
2025-06-25 16:10:03 02960_alter_table_part_query_parameter: [ OK ] 0.32 sec.
2025-06-25 16:10:03 02480_analyzer_alias_nullptr: [ OK ] 0.27 sec.
2025-06-25 16:10:03 02016_aggregation_spark_bar: [ OK ] 0.67 sec.
2025-06-25 16:10:03 01882_check_max_parts_to_merge_at_once: [ OK ] 0.57 sec.
2025-06-25 16:10:03 02008_materialize_column: [ OK ] 0.42 sec.
2025-06-25 16:10:03 00534_functions_bad_arguments4_long: [ SKIPPED ] 0.00 sec.
2025-06-25 16:10:03 Reason: not running for current build
2025-06-25 16:10:03 02345_filesystem_local: [ OK ] 0.48 sec.
2025-06-25 16:10:03 02023_storage_filelog: [ OK ] 4.08 sec.
2025-06-25 16:10:03 00464_array_element_out_of_range: [ OK ] 0.22 sec.
2025-06-25 16:10:03 02724_persist_interval_type: [ OK ] 0.32 sec.
2025-06-25 16:10:04 02814_create_index_uniq_noop: [ OK ] 0.27 sec.
2025-06-25 16:10:04 02875_parallel_replicas_cluster_all_replicas: [ OK ] 0.47 sec.
2025-06-25 16:10:04 02004_intersect_except_distinct_operators: [ OK ] 0.57 sec.
2025-06-25 16:10:04 00609_distributed_with_case_when_then: [ OK ] 0.32 sec.
2025-06-25 16:10:04 00610_materialized_view_forward_alter_partition_statements: [ OK ] 0.27 sec.
2025-06-25 16:10:04 01463_resample_overflow: [ OK ] 0.27 sec.
2025-06-25 16:10:04 01440_big_int_shift: [ OK ] 0.27 sec.
2025-06-25 16:10:04 02793_implicit_pretty_format_settings: [ OK ] 0.62 sec.
2025-06-25 16:10:04 02366_kql_func_dynamic: [ OK ] 1.02 sec.
2025-06-25 16:10:05 00075_shard_formatting_negate_of_negative_literal: [ OK ] 0.22 sec.
2025-06-25 16:10:05 02203_shebang: [ OK ] 0.52 sec.
2025-06-25 16:10:05 01527_materialized_view_stack_overflow: [ OK ] 0.77 sec.
2025-06-25 16:10:05 02342_window_view_different_struct: [ OK ] 0.47 sec.
2025-06-25 16:10:05 01076_range_reader_segfault: [ OK ] 0.32 sec.
2025-06-25 16:10:05 02817_structure_to_schema: [ OK ] 7.74 sec.
2025-06-25 16:10:05 00937_format_schema_rows_template: [ OK ] 1.92 sec.
2025-06-25 16:10:05 02126_url_auth: [ OK ] 1.02 sec.
2025-06-25 16:10:05 02961_analyzer_low_cardinality_fuzzer: [ OK ] 0.27 sec.
2025-06-25 16:10:06 03041_select_with_query_result: [ OK ] 0.32 sec.
2025-06-25 16:10:06 00450_higher_order_and_nullable: [ OK ] 0.22 sec.
2025-06-25 16:10:06 01410_full_join_and_null_predicates: [ OK ] 0.42 sec.
2025-06-25 16:10:06 00753_quantile_format: [ OK ] 0.37 sec.
2025-06-25 16:10:06 01095_tpch_like_smoke: [ OK ] 0.82 sec.
2025-06-25 16:10:06 02968_mysql_prefer_column_name_to_alias: [ OK ] 0.47 sec.
2025-06-25 16:10:06 01683_dist_INSERT_block_structure_mismatch: [ OK ] 0.27 sec.
2025-06-25 16:10:06 02954_analyzer_fuzz_i57086: [ OK ] 0.27 sec.
2025-06-25 16:10:07 01621_clickhouse_compressor: [ OK ] 0.62 sec.
2025-06-25 16:10:07 02293_http_header_summary_contains_exception_code_with_progress: [ OK ] 1.42 sec.
2025-06-25 16:10:07 00368_format_option_collision: [ OK ] 0.72 sec.
2025-06-25 16:10:07 02916_csv_infer_numbers_from_strings: [ OK ] 0.22 sec.
2025-06-25 16:10:08 01554_interpreter_integer_float: [ OK ] 0.27 sec.
2025-06-25 16:10:08 02784_parallel_replicas_automatic_decision: [ OK ] 6.03 sec.
2025-06-25 16:10:08 01782_field_oom: [ OK ] 1.32 sec.
2025-06-25 16:10:08 00506_shard_global_in_union: [ OK ] 0.32 sec.
2025-06-25 16:10:08 01889_clickhouse_client_config_format: [ OK ] 1.42 sec.
2025-06-25 16:10:08 01018_ddl_dictionaries_select: [ OK ] 0.42 sec.
2025-06-25 16:10:08 00876_wrong_arraj_join_column: [ OK ] 0.22 sec.
2025-06-25 16:10:08 00404_null_literal: [ OK ] 0.22 sec.
2025-06-25 16:10:08 01603_read_with_backoff_bug: [ OK ] 9.90 sec.
2025-06-25 16:10:08 02097_remove_sample_by: [ OK ] 0.32 sec.
2025-06-25 16:10:09 02500_bson_read_object_id: [ OK ] 0.52 sec.
2025-06-25 16:10:09 02271_temporary_table_show_rows_bytes: [ OK ] 0.22 sec.
2025-06-25 16:10:09 01773_datetime64_add_ubsan: [ OK ] 0.22 sec.
2025-06-25 16:10:09 02874_json_merge_patch_function_test: [ OK ] 0.32 sec.
2025-06-25 16:10:09 02002_row_level_filter_bug: [ OK ] 3.84 sec.
2025-06-25 16:10:09 02464_decimal_scale_buffer_overflow: [ OK ] 0.22 sec.
2025-06-25 16:10:09 01377_supertype_low_cardinality: [ OK ] 0.37 sec.
2025-06-25 16:10:09 00956_http_prepared_statements: [ OK ] 0.42 sec.
2025-06-25 16:10:09 03038_nested_dynamic_merges_compact_vertical: [ OK ] 2.13 sec.
2025-06-25 16:10:09 03156_nullable_number_tips: [ OK ] 0.33 sec.
2025-06-25 16:10:09 00161_rounding_functions: [ OK ] 0.42 sec.
2025-06-25 16:10:09 01502_bar_overflow: [ OK ] 0.37 sec.
2025-06-25 16:10:10 01881_to_week_monotonic_fix: [ OK ] 0.22 sec.
2025-06-25 16:10:10 01056_predicate_optimizer_bugs: [ OK ] 0.42 sec.
2025-06-25 16:10:10 01703_rewrite_aggregate_function_case_insensitive: [ OK ] 0.22 sec.
2025-06-25 16:10:10 01496_signedness_conversion_monotonicity: [ OK ] 0.27 sec.
2025-06-25 16:10:10 02968_full_sorting_join_fuzz: [ OK ] 1.92 sec.
2025-06-25 16:10:10 02784_schema_inference_null_as_default: [ OK ] 0.22 sec.
2025-06-25 16:10:10 01453_normalize_query_alias_uuid: [ OK ] 0.22 sec.
2025-06-25 16:10:10 02151_hash_table_sizes_stats_distributed: [ SKIPPED ] 0.00 sec.
2025-06-25 16:10:10 Reason: not running for current build
2025-06-25 16:10:10 03001_data_version_column: [ OK ] 0.27 sec.
2025-06-25 16:10:10 00938_dataset_test: [ OK ] 0.22 sec.
2025-06-25 16:10:10 01661_week_functions_string_args: [ OK ] 0.37 sec.
2025-06-25 16:10:10 02131_materialize_column_cast: [ OK ] 0.27 sec.
2025-06-25 16:10:10 00685_output_format_json_escape_forward_slashes: [ OK ] 0.22 sec.
2025-06-25 16:10:10 03143_parallel_replicas_mat_view_bug: [ OK ] 0.27 sec.
2025-06-25 16:10:10 00999_nullable_nested_types_4877: [ OK ] 0.27 sec.
2025-06-25 16:10:11 02713_sequence_match_serialization_fix: [ OK ] 0.22 sec.
2025-06-25 16:10:11 03206_no_exceptions_clickhouse_local: [ FAIL ] 0.42 sec.
2025-06-25 16:10:11 Reason: return code: 134, result:
2025-06-25 16:10:11
2025-06-25 16:10:11
2025-06-25 16:10:11
2025-06-25 16:10:11 stdout:
2025-06-25 16:10:11
2025-06-25 16:10:11
2025-06-25 16:10:11 Settings used in the test: --max_insert_threads 1 --group_by_two_level_threshold 455538 --group_by_two_level_threshold_bytes 1 --distributed_aggregation_memory_efficient 0 --fsync_metadata 1 --output_format_parallel_formatting 1 --input_format_parallel_parsing 1 --min_chunk_bytes_for_parallel_parsing 8271157 --max_read_buffer_size 581912 --prefer_localhost_replica 1 --max_block_size 68061 --max_joined_block_size_rows 48893 --max_threads 2 --optimize_append_index 1 --optimize_if_chain_to_multiif 0 --optimize_if_transform_strings_to_enum 0 --optimize_read_in_order 1 --optimize_or_like_chain 1 --optimize_substitute_columns 1 --enable_multiple_prewhere_read_steps 1 --read_in_order_two_level_merge_threshold 19 --optimize_aggregation_in_order 1 --aggregation_in_order_max_block_bytes 10262470 --use_uncompressed_cache 0 --min_bytes_to_use_direct_io 10737418240 --min_bytes_to_use_mmap_io 10737418240 --local_filesystem_read_method read --remote_filesystem_read_method threadpool --local_filesystem_read_prefetch 1 --filesystem_cache_segments_batch_size 0 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 0 --throw_on_error_from_cache_on_write_operations 1 --remote_filesystem_read_prefetch 0 --allow_prefetched_read_pool_for_remote_filesystem 0 --filesystem_prefetch_max_memory_usage 32Mi --filesystem_prefetches_limit 0 --filesystem_prefetch_min_bytes_for_single_read_task 8Mi --filesystem_prefetch_step_marks 0 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 0 --compile_sort_description 0 --merge_tree_coarse_index_granularity 15 --optimize_distinct_in_order 1 --max_bytes_before_external_sort 10737418240 --max_bytes_before_external_group_by 10737418240 --max_bytes_before_remerge_sort 283627084 --min_compress_block_size 232339 --max_compress_block_size 1944222 --merge_tree_compact_parts_min_granules_to_multibuffer_read 56 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 8371395 --http_wait_end_of_query False --enable_memory_bound_merging_of_aggregation_results 0 --min_count_to_compile_expression 0 --min_count_to_compile_aggregate_expression 3 --min_count_to_compile_sort_description 3 --session_timezone Mexico/BajaSur --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction True --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.79 --prefer_external_sort_block_bytes 1 --cross_join_min_rows_to_compress 100000000 --cross_join_min_bytes_to_compress 1 --min_external_table_block_size_bytes 100000000 --max_parsing_threads 0 --optimize_functions_to_subcolumns 1 --parallel_replicas_local_plan 0
2025-06-25 16:10:11
2025-06-25 16:10:11 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 0.0 --prefer_fetch_merged_part_size_threshold 10737418240 --vertical_merge_algorithm_min_rows_to_activate 1000000 --vertical_merge_algorithm_min_columns_to_activate 100 --allow_vertical_merges_from_compact_to_wide_parts 0 --min_merge_bytes_to_use_direct_io 10737418240 --index_granularity_bytes 3863463 --merge_max_block_size 268 --index_granularity 44397 --min_bytes_for_wide_part 1073741824 --marks_compress_block_size 47300 --primary_key_compress_block_size 58221 --replace_long_file_name_to_hash 0 --max_file_name_length 0 --min_bytes_for_full_part_storage 375272445 --compact_parts_max_bytes_to_buffer 495429246 --compact_parts_max_granules_to_buffer 33 --compact_parts_merge_max_bytes_to_prefetch_part 31208924 --cache_populated_by_fetch 0 --concurrent_part_removal_threshold 100 --old_parts_lifetime 411
2025-06-25 16:10:11
2025-06-25 16:10:11 Database: test_06bsporo
2025-06-25 16:10:11 01790_dist_INSERT_block_structure_mismatch_types_and_names: [ OK ] 0.27 sec.
2025-06-25 16:10:11 02872_null_as_default_nested: [ OK ] 2.42 sec.
2025-06-25 16:10:11 01293_external_sorting_limit_bug: [ OK ] 0.27 sec.
2025-06-25 16:10:11 02285_hex_bin_support_more_types: [ OK ] 0.27 sec.
2025-06-25 16:10:11 01104_fixed_string_like: [ OK ] 0.32 sec.
2025-06-25 16:10:11 02876_json_incomplete_types_as_strings_inference: [ OK ] 0.22 sec.
2025-06-25 16:10:11 02122_parallel_formatting_JSONCompactEachRowWithNamesAndTypes: [ OK ] 1.32 sec.
2025-06-25 16:10:11 03003_count_asterisk_filter: [ OK ] 0.22 sec.
2025-06-25 16:10:11 02476_query_parameters_without_serialisation: [ OK ] 0.32 sec.
2025-06-25 16:10:12 02096_totals_global_in_bug: [ OK ] 0.22 sec.
2025-06-25 16:10:12 00963_startsWith_force_primary_key: [ OK ] 0.22 sec.
2025-06-25 16:10:12 01513_count_without_select_sequence_consistency_zookeeper_long: [ OK ] 0.37 sec.
2025-06-25 16:10:12 01089_alter_settings_old_format: [ OK ] 0.27 sec.
2025-06-25 16:10:12 01430_fix_any_rewrite_aliases: [ OK ] 0.22 sec.
2025-06-25 16:10:12 00558_aggregate_merge_totals_with_arenas: [ OK ] 0.22 sec.
2025-06-25 16:10:12 01483_merge_table_join_and_group_by: [ OK ] 0.27 sec.
2025-06-25 16:10:12 00111_shard_external_sort_distributed: [ OK ] 6.39 sec.
2025-06-25 16:10:12 01812_has_generic: [ OK ] 0.22 sec.
2025-06-25 16:10:12 02374_analyzer_join_using: [ OK ] 1.52 sec.
2025-06-25 16:10:12 00901_joint_entropy: [ OK ] 0.22 sec.
2025-06-25 16:10:12 02932_group_by_null_fuzzer: [ OK ] 0.27 sec.
2025-06-25 16:10:12 00361_shared_array_offsets_and_squash_blocks: [ OK ] 0.27 sec.
2025-06-25 16:10:12 01960_lambda_precedence: [ OK ] 0.22 sec.
2025-06-25 16:10:12 02041_openssl_hash_functions_test: [ OK ] 0.27 sec.
2025-06-25 16:10:12 01098_sum: [ OK ] 0.27 sec.
2025-06-25 16:10:12 03034_recursive_cte_tree: [ OK ] 0.32 sec.
2025-06-25 16:10:12 03034_normalized_ast: [ OK ] 0.22 sec.
2025-06-25 16:10:12 00916_add_materialized_column_after: [ OK ] 0.22 sec.
2025-06-25 16:10:12 01670_log_comment: [ OK ] 0.62 sec.
2025-06-25 16:10:12 02016_agg_empty_result_bug_28880: [ OK ] 0.22 sec.
2025-06-25 16:10:13 01937_nested_chinese: [ OK ] 0.22 sec.
2025-06-25 16:10:13 00842_array_with_constant_overflow: [ OK ] 0.22 sec.
2025-06-25 16:10:13 00740_database_in_nested_view: [ OK ] 0.27 sec.
2025-06-25 16:10:13 03155_datasketches_ubsan: [ OK ] 0.22 sec.
2025-06-25 16:10:13 01069_database_memory: [ OK ] 0.27 sec.
2025-06-25 16:10:13 01425_decimal_parse_big_negative_exponent: [ OK ] 0.27 sec.
2025-06-25 16:10:13 03031_tuple_elimination_analyzer: [ OK ] 0.22 sec.
2025-06-25 16:10:13 00578_merge_table_sampling: [ OK ] 0.32 sec.
2025-06-25 16:10:13 02192_comment_error: [ OK ] 1.07 sec.
2025-06-25 16:10:13 01951_distributed_push_down_limit: [ OK ] 0.22 sec.
2025-06-25 16:10:13 01681_hyperscan_debug_assertion: [ SKIPPED ] 0.00 sec.
2025-06-25 16:10:13 Reason: not running for current build
2025-06-25 16:10:13 00551_parse_or_null: [ OK ] 0.27 sec.
2025-06-25 16:10:13 01073_bad_alter_partition: [ OK ] 0.32 sec.
2025-06-25 16:10:13 01641_memory_tracking_insert_optimize: [ OK ] 0.42 sec.
2025-06-25 16:10:14 01424_parse_date_time_bad_date: [ OK ] 0.27 sec.
2025-06-25 16:10:14 01284_port: [ OK ] 0.42 sec.
2025-06-25 16:10:14 01701_clear_projection_and_part_remove: [ OK ] 0.27 sec.
2025-06-25 16:10:14 01682_gather_utils_ubsan: [ OK ] 0.22 sec.
2025-06-25 16:10:14 00502_sum_map: [ OK ] 0.37 sec.
2025-06-25 16:10:14 02790_fix_coredump_when_compile_expression: [ OK ] 0.22 sec.
2025-06-25 16:10:14 01550_query_identifier_parameters: [ OK ] 1.37 sec.
2025-06-25 16:10:14 03014_analyzer_groupby_fuzz_60317: [ OK ] 0.22 sec.
2025-06-25 16:10:14 02377_modify_column_from_lc: [ OK ] 0.32 sec.
2025-06-25 16:10:14 01684_insert_specify_shard_id: [ OK ] 0.37 sec.
2025-06-25 16:10:14 01550_mutation_subquery: [ OK ] 0.22 sec.
2025-06-25 16:10:14 00266_read_overflow_mode: [ OK ] 0.22 sec.
2025-06-25 16:10:14 03142_alter_comment_parameterized_view: [ OK ] 0.22 sec.
2025-06-25 16:10:14 02525_analyzer_function_in_crash_fix: [ OK ] 0.22 sec.
2025-06-25 16:10:14 02581_width_bucket: [ OK ] 0.42 sec.
2025-06-25 16:10:15 02457_filesystem_function: [ OK ] 0.27 sec.
2025-06-25 16:10:15 02800_clickhouse_local_default_settings: [ OK ] 0.47 sec.
2025-06-25 16:10:15 00050_any_left_join: [ OK ] 0.22 sec.
2025-06-25 16:10:15 02455_default_union_except_intersect: [ OK ] 0.47 sec.
2025-06-25 16:10:16 02967_parallel_replicas_joins_and_analyzer: [ OK ] 1.22 sec.
2025-06-25 16:10:16 01076_predicate_optimizer_with_view: [ OK ] 0.32 sec.
2025-06-25 16:10:16 03130_convert_outer_join_to_inner_join: [ OK ] 0.32 sec.
2025-06-25 16:10:16 01277_fromUnixTimestamp64: [ OK ] 0.32 sec.
2025-06-25 16:10:17 01545_url_file_format_settings: [ OK ] 0.27 sec.
2025-06-25 16:10:17 02510_group_by_prewhere_null: [ OK ] 0.27 sec.
2025-06-25 16:10:17 01753_mutate_table_predicated_with_table: [ OK ] 0.22 sec.
2025-06-25 16:10:18 00954_client_prepared_statements: [ OK ] 3.48 sec.
2025-06-25 16:10:18 02771_if_constant_folding: [ OK ] 0.22 sec.
2025-06-25 16:10:18 02702_allow_skip_errors_enum: [ OK ] 1.07 sec.
2025-06-25 16:10:18 00389_concat_operator: [ OK ] 0.22 sec.
2025-06-25 16:10:19 02461_alter_update_respect_part_column_type_bug: [ OK ] 0.67 sec.
2025-06-25 16:10:19 02842_largestTriangleThreeBuckets_aggregate_function: [ OK ] 0.32 sec.
2025-06-25 16:10:19 03096_largest_triangle_3b_crash: [ OK ] 0.22 sec.
2025-06-25 16:10:19 03167_parametrized_view_with_cte: [ OK ] 0.22 sec.
2025-06-25 16:10:19 02999_analyzer_preimage_null: [ OK ] 0.22 sec.
2025-06-25 16:10:19 01412_group_array_moving_shard: [ OK ] 0.47 sec.
2025-06-25 16:10:20 00098_1_union_all: [ OK ] 0.27 sec.
2025-06-25 16:10:20 02661_read_from_archive_tzst: [ OK ] 6.88 sec.
2025-06-25 16:10:20 03015_optimize_final_rmt: [ OK ] 3.83 sec.
2025-06-25 16:10:20 01818_case_float_value_fangyc: [ OK ] 0.22 sec.
2025-06-25 16:10:20 02024_create_dictionary_with_comment: [ OK ] 0.22 sec.
2025-06-25 16:10:20 01869_reinterpret_as_fixed_string_uuid: [ OK ] 0.22 sec.
2025-06-25 16:10:20 00898_parsing_bad_diagnostic_message: [ OK ] 0.62 sec.
2025-06-25 16:10:20 00932_array_intersect_bug: [ OK ] 0.22 sec.
2025-06-25 16:10:20 03169_display_column_names_in_footer: [ OK ] 0.27 sec.
2025-06-25 16:10:20 02676_kafka_murmur_hash: [ OK ] 0.27 sec.
2025-06-25 16:10:20 00702_join_on_dups: [ OK ] 0.47 sec.
2025-06-25 16:10:20 03005_input_function_in_join: [ OK ] 0.27 sec.
2025-06-25 16:10:20 01411_xor_itai_shirav: [ OK ] 0.22 sec.
2025-06-25 16:10:21 02521_tsv_csv_custom_header_detection: [ OK ] 5.93 sec.
2025-06-25 16:10:21 00940_max_parts_in_total: [ OK ] 0.27 sec.
2025-06-25 16:10:21 00617_array_in: [ OK ] 0.27 sec.
2025-06-25 16:10:21 02354_parse_timedelta: [ OK ] 0.42 sec.
2025-06-25 16:10:21 00405_output_format_pretty_color: [ OK ] 0.32 sec.
2025-06-25 16:10:21 03130_analyzer_self_join_group_by: [ OK ] 0.27 sec.
2025-06-25 16:10:21 00458_merge_type_cast: [ OK ] 0.52 sec.
2025-06-25 16:10:21 00522_multidimensional: [ OK ] 0.52 sec.
2025-06-25 16:10:21 00173_compare_date_time_with_constant_string: [ OK ] 0.47 sec.
2025-06-25 16:10:21 03209_json_type_merges_small: [ SKIPPED ] 0.00 sec.
2025-06-25 16:10:21 Reason: not running for current build
2025-06-25 16:10:22 00535_parse_float_scientific: [ OK ] 0.22 sec.
2025-06-25 16:10:22 02554_log_faminy_support_storage_policy: [ OK ] 0.42 sec.
2025-06-25 16:10:22 00856_no_column_issue_4242: [ OK ] 0.27 sec.
2025-06-25 16:10:22 02864_restore_table_with_broken_part: [ OK ] 1.57 sec.
2025-06-25 16:10:23 02923_join_use_nulls_modulo: [ OK ] 0.22 sec.
2025-06-25 16:10:23 03143_group_by_constant_secondary: [ OK ] 0.22 sec.
2025-06-25 16:10:23 00320_between: [ OK ] 0.22 sec.
2025-06-25 16:10:23 00448_to_string_cut_to_zero: [ OK ] 0.22 sec.
2025-06-25 16:10:23 02994_inconsistent_formatting: [ OK ] 0.27 sec.
2025-06-25 16:10:23 03002_filter_skip_virtual_columns_with_non_deterministic_functions: [ OK ] 1.87 sec.
2025-06-25 16:10:23 01395_limit_more_cases: [ OK ] 13.75 sec.
2025-06-25 16:10:23 00569_parse_date_time_best_effort: [ OK ] 0.27 sec.
2025-06-25 16:10:23 01144_multiple_joins_rewriter_v2_and_lambdas: [ OK ] 0.32 sec.
2025-06-25 16:10:23 02412_nlp: [ OK ] 0.27 sec.
2025-06-25 16:10:24 00060_date_lut: [ OK ] 0.22 sec.
2025-06-25 16:10:24 01746_forbid_drop_column_referenced_by_mv: [ OK ] 0.47 sec.
2025-06-25 16:10:24 00199_ternary_operator_type_check: [ OK ] 0.42 sec.
2025-06-25 16:10:24 02151_lc_prefetch: [ SKIPPED ] 0.00 sec.
2025-06-25 16:10:24 Reason: not running for current build
2025-06-25 16:10:24 01825_new_type_json_11: [ OK ] 2.67 sec.
2025-06-25 16:10:24 00228_shard_quantiles_deterministic_merge_overflow: [ OK ] 0.27 sec.
2025-06-25 16:10:24 01305_polygons_union: [ OK ] 0.32 sec.
2025-06-25 16:10:24 01558_ttest_scipy: [ OK ] 1.32 sec.
2025-06-25 16:10:24 01475_read_subcolumns_3: [ OK ] 0.37 sec.
2025-06-25 16:10:25 02020_exponential_smoothing: [ OK ] 0.92 sec.
2025-06-25 16:10:25 00101_materialized_views_and_insert_without_explicit_database: [ OK ] 0.32 sec.
2025-06-25 16:10:25 01201_drop_column_compact_part_replicated_zookeeper_long: [ OK ] 0.52 sec.
2025-06-25 16:10:25 02864_profile_event_part_lock: [ OK ] 0.22 sec.
2025-06-25 16:10:25 03262_test_parquet_native_reader_int_logical_type: [ OK ] 0.87 sec.
2025-06-25 16:10:25 01323_add_scalars_in_time: [ OK ] 0.32 sec.
2025-06-25 16:10:25 02875_json_array_as_string: [ OK ] 0.22 sec.
2025-06-25 16:10:25 02725_alias_columns_should_not_allow_compression_codec: [ OK ] 0.27 sec.
2025-06-25 16:10:25 01428_h3_range_check: [ OK ] 0.22 sec.
2025-06-25 16:10:25 02703_jit_external_aggregation: [ SKIPPED ] 0.00 sec.
2025-06-25 16:10:25 Reason: not running for current build
2025-06-25 16:10:25 00218_like_regexp_newline: [ OK ] 0.27 sec.
2025-06-25 16:10:26 02813_array_agg: [ OK ] 0.22 sec.
2025-06-25 16:10:26 00908_bloom_filter_index: [ OK ] 11.25 sec.
2025-06-25 16:10:26 01010_pm_join_all_join_bug: [ OK ] 0.27 sec.
2025-06-25 16:10:26 01493_table_function_null: [ OK ] 0.22 sec.
2025-06-25 16:10:26 03032_scalars_create_as_select: [ OK ] 0.27 sec.
2025-06-25 16:10:26 01651_lc_insert_tiny_log_2: [ OK ] 2.48 sec.
2025-06-25 16:10:26 03150_dynamic_type_mv_insert: [ OK ] 0.37 sec.
2025-06-25 16:10:26 01825_new_type_json_9: [ OK ] 0.27 sec.
2025-06-25 16:10:27 03009_format_show_database: [ OK ] 0.72 sec.
2025-06-25 16:10:27 01547_query_log_current_database: [ OK ] 0.72 sec.
2025-06-25 16:10:27 02842_filesystem_cache_validate_path: [ OK ] 0.27 sec.
2025-06-25 16:10:27 02353_ascii: [ OK ] 0.22 sec.
2025-06-25 16:10:27 00743_limit_by_not_found_column: [ OK ] 0.27 sec.
2025-06-25 16:10:27 03198_unload_primary_key_outdated: [ OK ] 2.12 sec.
2025-06-25 16:10:27 02377_analyzer_in_function_set: [ OK ] 0.22 sec.
2025-06-25 16:10:27 02974_if_with_map: [ OK ] 0.27 sec.
2025-06-25 16:10:27 02910_replicated_merge_parameters_must_consistent: [ OK ] 0.47 sec.
2025-06-25 16:10:27 02015_async_inserts_7: [ OK ] 1.22 sec.
2025-06-25 16:10:27 01456_low_cardinality_sorting_bugfix: [ OK ] 0.27 sec.
2025-06-25 16:10:28 01825_new_type_json_3: [ OK ] 0.52 sec.
2025-06-25 16:10:28 01272_offset_without_limit: [ OK ] 0.27 sec.
2025-06-25 16:10:28 02471_wrong_date_monotonicity: [ OK ] 0.27 sec.
2025-06-25 16:10:28 02731_replace_partition_from_temporary_table: [ OK ] 0.97 sec.
2025-06-25 16:10:28 00632_aggregation_window_funnel: [ OK ] 0.72 sec.
2025-06-25 16:10:28 02812_pointwise_array_operations: [ OK ] 0.42 sec.
2025-06-25 16:10:28 01051_aggregate_function_crash: [ OK ] 0.22 sec.
2025-06-25 16:10:28 00072_in_types: [ OK ] 0.22 sec.
2025-06-25 16:10:28 00841_temporary_table_database: [ OK ] 0.27 sec.
2025-06-25 16:10:28 02535_analyzer_limit_offset: [ OK ] 0.22 sec.
2025-06-25 16:10:29 02493_analyzer_table_functions_untuple: [ OK ] 0.32 sec.
2025-06-25 16:10:29 01825_new_type_json_add_column: [ OK ] 0.37 sec.
2025-06-25 16:10:29 00022_func_higher_order_and_constants: [ OK ] 0.27 sec.
2025-06-25 16:10:29 01787_map_remote: [ OK ] 0.27 sec.
2025-06-25 16:10:29 00688_low_cardinality_defaults: [ OK ] 0.22 sec.
2025-06-25 16:10:29 02428_combinators_with_over_statement: [ OK ] 0.27 sec.
2025-06-25 16:10:29 02008_test_union_distinct_in_subquery: [ OK ] 0.32 sec.
2025-06-25 16:10:29 02373_datetime64_monotonicity: [ OK ] 1.97 sec.
2025-06-25 16:10:29 01825_type_json_from_map: [ OK ] 1.52 sec.
2025-06-25 16:10:30 02933_ephemeral_mv: [ OK ] 0.27 sec.
2025-06-25 16:10:30 03023_zeros_generate_random_with_limit_progress_bar: [ OK ] 0.42 sec.
2025-06-25 16:10:30 02024_join_on_or_long: [ OK ] 0.97 sec.
2025-06-25 16:10:30 02381_parse_array_of_tuples: [ OK ] 0.22 sec.
2025-06-25 16:10:30 00751_low_cardinality_nullable_group_by: [ OK ] 0.72 sec.
2025-06-25 16:10:30 00188_constants_as_arguments_of_aggregate_functions: [ OK ] 0.22 sec.
2025-06-25 16:10:30 00709_virtual_column_partition_id: [ OK ] 0.27 sec.
2025-06-25 16:10:30 02931_alter_materialized_view_query_inconsistent: [ OK ] 0.22 sec.
2025-06-25 16:10:30 02699_polygons_sym_difference_rollup: [ OK ] 0.22 sec.
2025-06-25 16:10:30 01010_partial_merge_join: [ OK ] 0.92 sec.
2025-06-25 16:10:30 01667_aes_args_check: [ OK ] 0.17 sec.
2025-06-25 16:10:30 00227_quantiles_timing_arbitrary_order: [ OK ] 0.27 sec.
2025-06-25 16:10:31 01037_zookeeper_check_table_empty_pk: [ OK ] 0.27 sec.
2025-06-25 16:10:31 02457_morton_coding: [ OK ] 0.62 sec.
2025-06-25 16:10:31 01783_parallel_formatting_memory: [ OK ] 0.57 sec.
2025-06-25 16:10:31 01038_array_of_unnamed_tuples: [ OK ] 0.22 sec.
2025-06-25 16:10:31 00560_float_leading_plus_in_exponent: [ OK ] 0.25 sec.
2025-06-25 16:10:31 00534_functions_bad_arguments7: [ SKIPPED ] 0.00 sec.
2025-06-25 16:10:31 Reason: not running for current build
2025-06-25 16:10:31 01458_count_digits: [ OK ] 0.27 sec.
2025-06-25 16:10:32 02533_generate_random_schema_inference: [ OK ] 0.22 sec.
2025-06-25 16:10:32 01273_arrow_stream: [ OK ] 11.80 sec.
2025-06-25 16:10:32 03038_nested_dynamic_merges_wide_horizontal: [ OK ] 2.63 sec.
2025-06-25 16:10:32 00033_fixed_string_to_string: [ OK ] 0.27 sec.
2025-06-25 16:10:33 02154_bit_slice_for_fixedstring: [ OK ] 0.78 sec.
2025-06-25 16:10:33 03007_column_nullable_uninitialzed_value: [ OK ] 0.22 sec.
2025-06-25 16:10:33 02135_local_create_db: [ OK ] 0.74 sec.
2025-06-25 16:10:33 03098_prefer_column_to_alias_subquery: [ OK ] 0.57 sec.
2025-06-25 16:10:33 01049_window_view_window_functions: [ OK ] 0.58 sec.
2025-06-25 16:10:33 00152_totals_in_subquery: [ OK ] 0.24 sec.
2025-06-25 16:10:33 00926_zookeeper_adaptive_index_granularity_replicated_merge_tree_long: [ OK ] 3.29 sec.
2025-06-25 16:10:34 02475_analyzer_join_tree_subquery: [ OK ] 0.27 sec.
2025-06-25 16:10:34 01428_hash_set_nan_key: [ OK ] 0.27 sec.
2025-06-25 16:10:34 02771_ignore_data_skipping_indices: [ OK ] 0.48 sec.
2025-06-25 16:10:34 01375_null_issue_3767: [ OK ] 0.29 sec.
2025-06-25 16:10:34 02559_add_parts: [ OK ] 0.27 sec.
2025-06-25 16:10:35 03126_column_not_under_group_by: [ OK ] 0.22 sec.
2025-06-25 16:10:35 02883_zookeeper_finalize_stress: [ OK ] 3.49 sec.
2025-06-25 16:10:35 02946_literal_alias_misclassification: [ OK ] 0.22 sec.
2025-06-25 16:10:35 01834_alias_columns_laziness_filimonov: [ OK ] 1.19 sec.
2025-06-25 16:10:35 01060_window_view_event_tumble_to_asc: [ OK ] 1.88 sec.
2025-06-25 16:10:35 00674_has_array_enum: [ OK ] 0.22 sec.
2025-06-25 16:10:35 01656_ipv4_bad_formatting: [ OK ] 0.22 sec.
2025-06-25 16:10:35 00230_array_functions_has_count_equal_index_of_non_const_second_arg: [ OK ] 0.32 sec.
2025-06-25 16:10:35 02815_range_dict_no_direct_join: [ OK ] 0.28 sec.
2025-06-25 16:10:35 01115_join_with_dictionary: [ OK ] 0.52 sec.
2025-06-25 16:10:35 03041_analyzer_gigachad_join: [ OK ] 0.27 sec.
2025-06-25 16:10:36 02454_set_parameters_formatting: [ OK ] 0.42 sec.
2025-06-25 16:10:36 01050_engine_join_crash: [ OK ] 0.32 sec.
2025-06-25 16:10:36 01532_collate_in_low_cardinality: [ OK ] 0.32 sec.
2025-06-25 16:10:36 00370_duplicate_columns_in_subqueries: [ OK ] 0.27 sec.
2025-06-25 16:10:36 01683_intdiv_ubsan: [ OK ] 0.27 sec.
2025-06-25 16:10:36 01143_trivial_count_with_join: [ OK ] 0.27 sec.
2025-06-25 16:10:36 02935_http_content_type_with_http_headers_progress: [ OK ] 5.54 sec.
2025-06-25 16:10:36 01213_alter_table_rename_nested: [ OK ] 0.32 sec.
2025-06-25 16:10:36 01865_aggregator_overflow_row: [ OK ] 0.32 sec.
2025-06-25 16:10:36 01499_json_named_tuples: [ OK ] 0.27 sec.
2025-06-25 16:10:37 02024_compression_in_query: [ OK ] 2.63 sec.
2025-06-25 16:10:37 01280_null_in: [ OK ] 0.27 sec.
2025-06-25 16:10:37 02522_different_types_in_storage_merge: [ OK ] 0.27 sec.
2025-06-25 16:10:37 02551_ipv4_implicit_uint64: [ OK ] 0.27 sec.
2025-06-25 16:10:37 03116_analyzer_explicit_alias_as_column_name: [ OK ] 0.22 sec.
2025-06-25 16:10:37 01646_rewrite_sum_if: [ OK ] 0.37 sec.
2025-06-25 16:10:37 00373_group_by_tuple: [ OK ] 0.27 sec.
2025-06-25 16:10:37 00679_replace_asterisk: [ OK ] 0.27 sec.
2025-06-25 16:10:38 01825_type_json_8: [ OK ] 2.07 sec.
2025-06-25 16:10:38 01284_view_and_extremes_bug: [ OK ] 0.27 sec.
2025-06-25 16:10:38 02982_comments_in_system_tables: [ OK ] 0.82 sec.
2025-06-25 16:10:38 01544_file_engine_settings: [ OK ] 0.82 sec.
2025-06-25 16:10:38 00758_array_reverse: [ OK ] 0.32 sec.
2025-06-25 16:10:38 02311_range_hashed_dictionary_range_cast: [ OK ] 0.27 sec.
2025-06-25 16:10:38 02457_tuple_of_intervals: [ OK ] 0.47 sec.
2025-06-25 16:10:38 02734_sparse_columns_short_circuit: [ OK ] 0.32 sec.
2025-06-25 16:10:38 02160_client_autocomplete_parse_query: [ OK ] 1.77 sec.
2025-06-25 16:10:39 02224_parallel_distributed_insert_select_cluster: [ OK ] 0.37 sec.
2025-06-25 16:10:39 03006_mv_deduplication_throw_if_async_insert: [ OK ] 0.52 sec.
2025-06-25 16:10:39 00292_parser_tuple_element: [ OK ] 0.22 sec.
2025-06-25 16:10:39 02971_functions_to_subcolumns_variant: [ OK ] 0.27 sec.
2025-06-25 16:10:39 00331_final_and_prewhere: [ OK ] 0.32 sec.
2025-06-25 16:10:39 02680_illegal_type_of_filter_projection: [ OK ] 0.32 sec.
2025-06-25 16:10:39 01441_array_combinator: [ OK ] 0.27 sec.
2025-06-25 16:10:39 02294_decimal_second_errors: [ OK ] 0.27 sec.
2025-06-25 16:10:39 03204_distributed_with_scalar_subquery: [ OK ] 0.32 sec.
2025-06-25 16:10:39 00700_decimal_complex_types: [ OK ] 1.22 sec.
2025-06-25 16:10:39 02499_escaped_quote_schema_inference: [ OK ] 0.22 sec.
2025-06-25 16:10:40 02705_projection_and_ast_optimizations_bug: [ OK ] 0.27 sec.
2025-06-25 16:10:40 02815_logical_error_cannot_get_column_name_of_set: [ OK ] 0.31 sec.
2025-06-25 16:10:40 01014_count_of_merges_metrics: [ OK ] 0.36 sec.
2025-06-25 16:10:40 01528_setting_aggregate_functions_null_for_empty: [ OK ] 0.37 sec.
2025-06-25 16:10:40 00835_if_generic_case: [ OK ] 0.32 sec.
2025-06-25 16:10:40 02294_dictionaries_hierarchical_index: [ OK ] 0.42 sec.
2025-06-25 16:10:40 00623_in_partition_key: [ OK ] 0.62 sec.
2025-06-25 16:10:40 02494_parser_string_binary_literal: [ OK ] 0.32 sec.
2025-06-25 16:10:40 00712_prewhere_with_alias_bug: [ OK ] 0.27 sec.
2025-06-25 16:10:41 02721_url_cluster: [ OK ] 0.57 sec.
2025-06-25 16:10:41 02915_lazy_loading_of_base_backups: [ OK ] 3.13 sec.
2025-06-25 16:10:41 01660_join_or_all: [ OK ] 0.72 sec.
2025-06-25 16:10:41 03006_async_insert_deadlock_log: [ OK ] 1.37 sec.
2025-06-25 16:10:41 02813_func_now_and_alias: [ OK ] 0.27 sec.
2025-06-25 16:10:41 03227_dynamic_subcolumns_enumerate_streams: [ OK ] 0.22 sec.
2025-06-25 16:10:41 00613_shard_distributed_max_execution_time: [ OK ] 0.27 sec.
2025-06-25 16:10:41 01032_duplicate_column_insert_query: [ OK ] 0.27 sec.
2025-06-25 16:10:42 02676_trailing_commas: [ OK ] 0.27 sec.
2025-06-25 16:10:42 01926_bin_unbin: [ OK ] 0.32 sec.
2025-06-25 16:10:42 02015_async_inserts_1: [ OK ] 1.62 sec.
2025-06-25 16:10:42 03291_json_big_structure_deserialization: [ OK ] 5.88 sec.
2025-06-25 16:10:42 02353_translate: [ OK ] 0.32 sec.
2025-06-25 16:10:42 00210_insert_select_extremes_http: [ OK ] 0.52 sec.
2025-06-25 16:10:42 00520_tuple_values_interpreter: [ OK ] 0.27 sec.
2025-06-25 16:10:42 02891_rename_table_without_keyword: [ OK ] 0.37 sec.
2025-06-25 16:10:42 01921_test_progress_bar: [ OK ] 0.47 sec.
2025-06-25 16:10:42 01072_optimize_skip_unused_shards_const_expr_eval: [ OK ] 0.57 sec.
2025-06-25 16:10:42 02988_join_using_prewhere_pushdown: [ OK ] 0.27 sec.
2025-06-25 16:10:43 02995_bad_formatting_union_intersect: [ OK ] 0.27 sec.
2025-06-25 16:10:43 02375_pretty_formats: [ OK ] 0.37 sec.
2025-06-25 16:10:43 00125_array_element_of_array_of_tuple: [ OK ] 0.27 sec.
2025-06-25 16:10:43 03001_block_offset_column: [ OK ] 0.52 sec.
2025-06-25 16:10:43 02903_client_insert_in_background: [ OK ] 1.22 sec.
2025-06-25 16:10:43 00956_join_use_nulls_with_array_column: [ OK ] 0.27 sec.
2025-06-25 16:10:43 00700_decimal_with_default_precision_and_scale: [ OK ] 0.27 sec.
2025-06-25 16:10:43 00700_decimal_empty_aggregates: [ OK ] 0.62 sec.
2025-06-25 16:10:43 00324_hashing_enums: [ OK ] 0.22 sec.
2025-06-25 16:10:44 02026_accurate_cast_or_default: [ OK ] 0.52 sec.
2025-06-25 16:10:44 03004_force_null_for_omitted: [ OK ] 0.52 sec.
2025-06-25 16:10:44 01211_optimize_skip_unused_shards_type_mismatch: [ OK ] 0.28 sec.
2025-06-25 16:10:44 02932_punycode: [ OK ] 0.77 sec.
2025-06-25 16:10:44 02940_json_array_of_unnamed_tuples_inference: [ OK ] 0.27 sec.
2025-06-25 16:10:44 02959_system_database_engines: [ OK ] 0.22 sec.
2025-06-25 16:10:44 00085_visible_width_of_tuple_of_dates: [ OK ] 0.22 sec.
2025-06-25 16:10:44 03008_deduplication_wrong_mv: [ OK ] 0.27 sec.
2025-06-25 16:10:45 02833_local_udf_options: [ OK ] 0.62 sec.
2025-06-25 16:10:45 01802_formatDateTime_DateTime64_century: [ OK ] 0.27 sec.
2025-06-25 16:10:45 02206_clickhouse_local_use_database: [ OK ] 0.67 sec.
2025-06-25 16:10:45 02935_ipv6_bit_operations: [ OK ] 0.27 sec.
2025-06-25 16:10:46 01529_bad_memory_tracking: [ OK ] 2.48 sec.
2025-06-25 16:10:46 02360_send_logs_level_colors: [ OK ] 1.17 sec.
2025-06-25 16:10:46 03002_analyzer_prewhere: [ OK ] 0.32 sec.
2025-06-25 16:10:46 02456_test_zero_copy_mutation: [ OK ] 0.37 sec.
2025-06-25 16:10:47 01019_materialized_view_select_extra_columns: [ OK ] 0.32 sec.
2025-06-25 16:10:47 02596_build_set_and_remote: [ OK ] 0.52 sec.
2025-06-25 16:10:47 02128_cast_nullable: [ OK ] 0.27 sec.
2025-06-25 16:10:47 01923_ttl_with_modify_column: [ OK ] 0.42 sec.
2025-06-25 16:10:48 02518_parquet_arrow_orc_boolean_value: [ OK ] 0.97 sec.
2025-06-25 16:10:49 01710_projection_group_by_order_by: [ OK ] 0.22 sec.
2025-06-25 16:10:49 02201_use_skip_indexes_if_final: [ OK ] 0.37 sec.
2025-06-25 16:10:49 02293_h3_hex_ring: [ OK ] 0.42 sec.
2025-06-25 16:10:50 02790_url_multiple_tsv_files: [ OK ] 0.87 sec.
2025-06-25 16:10:50 02844_max_backup_bandwidth_s3: [ OK ] 25.04 sec.
2025-06-25 16:10:50 02134_async_inserts_formats: [ OK ] 6.49 sec.
2025-06-25 16:10:51 02267_type_inference_for_insert_into_function_null: [ OK ] 0.27 sec.
2025-06-25 16:10:51 02843_backup_use_same_password_for_base_backup: [ OK ] 3.58 sec.
2025-06-25 16:10:51 02813_seriesOutliersDetectTukey: [ OK ] 0.37 sec.
2025-06-25 16:10:51 01303_polygons_equals: [ OK ] 0.27 sec.
2025-06-25 16:10:51 02245_s3_virtual_columns: [ OK ] 0.32 sec.
2025-06-25 16:10:51 00652_mutations_alter_update: [ OK ] 9.14 sec.
2025-06-25 16:10:51 01914_index_bgranvea: [ OK ] 0.27 sec.
2025-06-25 16:10:51 02290_client_insert_cancel: [ OK ] 0.87 sec.
2025-06-25 16:10:51 02293_h3_line: [ OK ] 0.37 sec.
2025-06-25 16:10:51 03145_asof_join_ddb_inequalities: [ OK ] 0.37 sec.
2025-06-25 16:10:51 03015_aggregator_empty_data_multiple_blocks: [ OK ] 0.22 sec.
2025-06-25 16:10:52 03157_dynamic_type_json: [ OK ] 0.27 sec.
2025-06-25 16:10:52 02129_skip_quoted_fields: [ OK ] 6.89 sec.
2025-06-25 16:10:52 02553_new_type_json_attach_partition: [ OK ] 0.82 sec.
2025-06-25 16:10:53 00906_low_cardinality_rollup: [ OK ] 0.32 sec.
2025-06-25 16:10:53 01611_string_to_low_cardinality_key_alter: [ OK ] 0.37 sec.
2025-06-25 16:10:53 01475_read_subcolumns_2: [ OK ] 0.42 sec.
2025-06-25 16:10:53 00823_capnproto_input: [ OK ] 1.87 sec.
2025-06-25 16:10:53 00695_pretty_max_column_pad_width: [ OK ] 0.27 sec.
2025-06-25 16:10:53 01470_columns_transformers: [ OK ] 0.52 sec.
2025-06-25 16:10:53 00619_union_highlite: [ OK ] 0.27 sec.
2025-06-25 16:10:53 03210_dynamic_squashing: [ OK ] 0.57 sec.
2025-06-25 16:10:53 00356_analyze_aggregations_and_union_all: [ OK ] 0.27 sec.
2025-06-25 16:10:54 03008_deduplication_insert_into_partitioned_table: [ OK ] 0.77 sec.
2025-06-25 16:10:54 01780_column_sparse_distinct: [ OK ] 0.27 sec.
2025-06-25 16:10:54 02732_rename_after_processing: [ OK ] 3.03 sec.
2025-06-25 16:10:54 02354_window_expression_with_aggregation_expression: [ OK ] 0.22 sec.
2025-06-25 16:10:54 00933_alter_ttl: [ OK ] 0.37 sec.
2025-06-25 16:10:54 02967_index_hint_crash: [ OK ] 0.27 sec.
2025-06-25 16:10:54 00369_int_div_of_float: [ OK ] 0.28 sec.
2025-06-25 16:10:54 01064_incremental_streaming_from_2_src_with_feedback: [ OK ] 1.12 sec.
2025-06-25 16:10:54 03230_subcolumns_mv: [ OK ] 0.32 sec.
2025-06-25 16:10:55 02246_flatten_tuple: [ OK ] 0.27 sec.
2025-06-25 16:10:55 02591_bson_long_tuple: [ OK ] 0.22 sec.
2025-06-25 16:10:55 02695_logical_optimizer_alias_bug: [ OK ] 0.27 sec.
2025-06-25 16:10:55 03080_analyzer_prefer_column_name_to_alias__virtual_columns: [ OK ] 0.27 sec.
2025-06-25 16:10:55 02030_client_unknown_database: [ OK ] 0.67 sec.
2025-06-25 16:10:55 00165_transform_non_const_default: [ OK ] 0.32 sec.
2025-06-25 16:10:55 03037_dynamic_merges_2_horizontal_compact_merge_tree: [ OK ] 0.52 sec.
2025-06-25 16:10:55 03199_merge_filters_bug: [ OK ] 0.37 sec.
2025-06-25 16:10:55 02782_values_null_to_lc_nullable: [ OK ] 0.22 sec.
2025-06-25 16:10:56 01710_projection_row_policy: [ OK ] 0.32 sec.
2025-06-25 16:10:56 02677_grace_hash_limit_race: [ OK ] 0.27 sec.
2025-06-25 16:10:56 02179_bool_type: [ OK ] 0.47 sec.
2025-06-25 16:10:56 01781_merge_tree_deduplication: [ OK ] 0.72 sec.
2025-06-25 16:10:56 00843_optimize_predicate_and_rename_table: [ OK ] 0.27 sec.
2025-06-25 16:10:56 01567_system_processes_current_database: [ OK ] 0.22 sec.
2025-06-25 16:10:56 00564_initial_column_values_with_default_expression: [ OK ] 0.22 sec.
2025-06-25 16:10:56 03274_dynamic_column_data_race_with_concurrent_hj: [ OK ] 0.27 sec.
2025-06-25 16:10:57 01497_alias_on_default_array: [ OK ] 0.27 sec.
2025-06-25 16:10:57 03036_schema_inference_cache_s3_archives: [ OK ] 0.27 sec.
2025-06-25 16:10:57 00650_csv_with_specified_quote_rule: [ OK ] 3.78 sec.
2025-06-25 16:10:57 01392_column_resolve: [ OK ] 0.32 sec.
2025-06-25 16:10:57 00280_hex_escape_sequence: [ OK ] 0.27 sec.
2025-06-25 16:10:58 00779_all_right_join_max_block_size: [ OK ] 0.22 sec.
2025-06-25 16:10:58 02560_vertical_merge_memory_usage: [ OK ] 1.72 sec.
2025-06-25 16:10:58 01280_min_map_max_map: [ OK ] 0.42 sec.
2025-06-25 16:10:58 02291_dictionary_scalar_subquery_reload: [ OK ] 0.28 sec.
2025-06-25 16:10:58 03046_column_in_block_array_join: [ OK ] 0.27 sec.
2025-06-25 16:10:58 02975_intdiv_with_decimal: [ OK ] 0.47 sec.
2025-06-25 16:10:58 02906_flatten_only_true_nested: [ OK ] 0.27 sec.
2025-06-25 16:10:59 02692_multiple_joins_unicode: [ OK ] 0.32 sec.
2025-06-25 16:10:59 02227_union_match_by_name: [ OK ] 0.22 sec.
2025-06-25 16:10:59 00223_shard_distributed_aggregation_memory_efficient: [ OK ] 4.38 sec.
2025-06-25 16:10:59 02935_format_with_arbitrary_types: [ OK ] 0.57 sec.
2025-06-25 16:10:59 00825_protobuf_format_nested_in_nested: [ OK ] 1.48 sec.
2025-06-25 16:10:59 02161_addressToLineWithInlines: [ SKIPPED ] 0.00 sec.
2025-06-25 16:10:59 Reason: not running for current build
2025-06-25 16:11:00 01090_fixed_string_bit_ops: [ OK ] 0.27 sec.
2025-06-25 16:11:00 01681_bloom_filter_nullable_column: [ OK ] 0.47 sec.
2025-06-25 16:11:00 00975_sample_prewhere_distributed: [ OK ] 0.32 sec.
2025-06-25 16:11:00 00937_test_use_header_csv: [ OK ] 3.58 sec.
2025-06-25 16:11:00 01825_type_json_field: [ OK ] 0.37 sec.
2025-06-25 16:11:00 03237_max_map_state_decimal_serialization: [ OK ] 0.27 sec.
2025-06-25 16:11:00 02513_broken_datetime64_init_on_mac: [ OK ] 0.22 sec.
2025-06-25 16:11:01 02725_any_join_single_row: [ OK ] 0.32 sec.
2025-06-25 16:11:01 02422_insert_different_granularity: [ OK ] 0.48 sec.
2025-06-25 16:11:01 01854_HTTP_dict_decompression: [ OK ] 0.77 sec.
2025-06-25 16:11:01 01267_alter_default_key_columns_zookeeper_long: [ OK ] 0.42 sec.
2025-06-25 16:11:01 02205_postgresql_functions: [ OK ] 0.42 sec.
2025-06-25 16:11:01 00530_arrays_of_nothing: [ OK ] 0.27 sec.
2025-06-25 16:11:01 02456_async_inserts_logs: [ OK ] 2.73 sec.
2025-06-25 16:11:02 00278_insert_already_sorted: [ OK ] 0.47 sec.
2025-06-25 16:11:02 00495_reading_const_zero_column: [ OK ] 0.32 sec.
2025-06-25 16:11:02 01666_lcm_ubsan: [ OK ] 0.37 sec.
2025-06-25 16:11:02 00926_adaptive_index_granularity_merge_tree: [ OK ] 1.12 sec.
2025-06-25 16:11:03 00804_test_custom_compression_codecs: [ OK ] 0.72 sec.
2025-06-25 16:11:03 02723_jit_aggregation_bug_48120: [ OK ] 0.32 sec.
2025-06-25 16:11:03 02024_compile_expressions_with_short_circuit_evaluation: [ OK ] 0.27 sec.
2025-06-25 16:11:03 02941_variant_type_4: [ OK ] 11.40 sec.
2025-06-25 16:11:03 02125_lz4_compression_bug_JSONCompactEachRow: [ OK ] 3.98 sec.
2025-06-25 16:11:03 02408_to_fixed_string_short_circuit: [ OK ] 0.22 sec.
2025-06-25 16:11:03 00143_number_classification_functions: [ OK ] 0.37 sec.
2025-06-25 16:11:03 00996_neighbor: [ OK ] 0.37 sec.
2025-06-25 16:11:04 01825_new_type_json_7: [ OK ] 1.62 sec.
2025-06-25 16:11:04 00974_low_cardinality_cast: [ OK ] 0.32 sec.
2025-06-25 16:11:04 02052_last_granula_adjust_logical_error: [ OK ] 0.57 sec.
2025-06-25 16:11:04 02141_clickhouse_local_interactive_table: [ OK ] 0.67 sec.
2025-06-25 16:11:04 01561_aggregate_functions_of_key_with_join: [ OK ] 0.27 sec.
2025-06-25 16:11:04 02366_asof_optimize_predicate_bug_37813: [ OK ] 0.32 sec.
2025-06-25 16:11:04 02133_issue_32458: [ OK ] 0.27 sec.
2025-06-25 16:11:04 01542_collate_in_array: [ OK ] 0.32 sec.
2025-06-25 16:11:04 03169_time_virtual_column: [ OK ] 1.57 sec.
2025-06-25 16:11:04 03010_sum_to_to_count_if_nullable: [ OK ] 0.27 sec.
2025-06-25 16:11:04 00927_disable_hyperscan: [ OK ] 0.37 sec.
2025-06-25 16:11:05 00552_logical_functions_simple: [ OK ] 0.32 sec.
2025-06-25 16:11:05 03208_array_of_json_read_subcolumns_2_wide_merge_tree: [ SKIPPED ] 0.00 sec.
2025-06-25 16:11:05 Reason: not running for current build
2025-06-25 16:11:05 01880_remote_ipv6: [ OK ] 0.32 sec.
2025-06-25 16:11:05 02989_replicated_merge_tree_invalid_metadata_version: [ OK ] 0.42 sec.
2025-06-25 16:11:05 00849_multiple_comma_join_2: [ OK ] 0.67 sec.
2025-06-25 16:11:05 02151_http_s_structure_set_eof: [ OK ] 1.42 sec.
2025-06-25 16:11:05 02816_check_projection_metadata: [ OK ] 0.27 sec.
2025-06-25 16:11:05 03093_bug_gcd_codec: [ OK ] 0.37 sec.
2025-06-25 16:11:05 02812_subquery_operators: [ OK ] 0.27 sec.
2025-06-25 16:11:06 00804_test_custom_compression_codes_log_storages: [ OK ] 0.57 sec.
2025-06-25 16:11:06 02731_parallel_replicas_join_subquery: [ OK ] 0.97 sec.
2025-06-25 16:11:06 00942_dataparts_500: [ OK ] 0.52 sec.
2025-06-25 16:11:06 02003_WithMergeableStateAfterAggregationAndLimit_LIMIT_BY_LIMIT_OFFSET: [ OK ] 0.32 sec.
2025-06-25 16:11:07 02834_formats_with_variable_number_of_columns: [ OK ] 0.37 sec.
2025-06-25 16:11:07 00981_topK_topKWeighted_long: [ OK ] 6.03 sec.
2025-06-25 16:11:07 03064_analyzer_named_subqueries: [ OK ] 0.27 sec.
2025-06-25 16:11:07 00341_squashing_insert_select2: [ OK ] 0.37 sec.
2025-06-25 16:11:07 00098_k_union_all: [ OK ] 0.27 sec.
2025-06-25 16:11:07 02221_system_zookeeper_unrestricted_like: [ OK ] 2.38 sec.
2025-06-25 16:11:07 01600_remerge_sort_lowered_memory_bytes_ratio: [ OK ] 0.97 sec.
2025-06-25 16:11:07 03208_uniq_with_empty_tuple: [ OK ] 0.22 sec.
2025-06-25 16:11:08 03003_functions_to_subcolumns_final: [ OK ] 0.32 sec.
2025-06-25 16:11:08 03151_dynamic_type_scale_max_types: [ OK ] 0.37 sec.
2025-06-25 16:11:08 01925_json_as_string_data_in_square_brackets: [ OK ] 0.27 sec.
2025-06-25 16:11:08 02311_hashed_array_dictionary_hierarchical_functions: [ OK ] 0.37 sec.
2025-06-25 16:11:08 03040_array_sum_and_join: [ OK ] 0.27 sec.
2025-06-25 16:11:08 01052_array_reduce_exception: [ OK ] 0.22 sec.
2025-06-25 16:11:08 02246_is_secure_query_log: [ OK ] 2.88 sec.
2025-06-25 16:11:08 01451_detach_drop_part: [ OK ] 0.42 sec.
2025-06-25 16:11:08 02834_array_exists_segfault: [ OK ] 0.22 sec.
2025-06-25 16:11:08 02212_h3_get_pentagon_indexes: [ OK ] 0.37 sec.
2025-06-25 16:11:09 02294_optimize_aggregation_in_order_prefix_Array_functions: [ OK ] 0.27 sec.
2025-06-25 16:11:09 02874_toDaysSinceYearZero: [ OK ] 0.32 sec.
2025-06-25 16:11:09 03014_window_view_crash: [ OK ] 0.27 sec.
2025-06-25 16:11:09 01080_window_view_inner_table_memory_hop: [ OK ] 1.72 sec.
2025-06-25 16:11:09 02931_size_virtual_column_use_structure_from_insertion_table: [ OK ] 0.57 sec.
2025-06-25 16:11:09 01268_procfs_metrics: [ OK ] 0.77 sec.
2025-06-25 16:11:09 01906_partition_by_multiply_by_zero: [ OK ] 0.27 sec.
2025-06-25 16:11:10 01385_not_function: [ OK ] 0.27 sec.
2025-06-25 16:11:10 02015_async_inserts_2: [ OK ] 0.77 sec.
2025-06-25 16:11:10 03203_fill_missed_subcolumns: [ OK ] 0.37 sec.
2025-06-25 16:11:10 01021_only_tuple_columns: [ OK ] 0.37 sec.
2025-06-25 16:11:10 01945_system_warnings: [ OK ] 1.72 sec.
2025-06-25 16:11:10 01615_two_args_function_index_fix: [ OK ] 0.27 sec.
2025-06-25 16:11:10 01183_custom_separated_format_http: [ OK ] 1.77 sec.
2025-06-25 16:11:10 02025_subcolumns_compact_parts: [ OK ] 0.32 sec.
2025-06-25 16:11:10 00116_storage_set: [ OK ] 0.37 sec.
2025-06-25 16:11:11 02458_empty_hdfs_url: [ OK ] 0.27 sec.
2025-06-25 16:11:11 03228_variant_permutation_issue: [ OK ] 0.42 sec.
2025-06-25 16:11:11 00591_columns_removal_union_all: [ OK ] 0.27 sec.
2025-06-25 16:11:11 02999_scalar_subqueries_bug_1: [ OK ] 0.22 sec.
2025-06-25 16:11:11 02813_any_value: [ OK ] 0.22 sec.
2025-06-25 16:11:12 01001_enums_in_in_section: [ OK ] 0.22 sec.
2025-06-25 16:11:12 01356_state_resample: [ OK ] 0.32 sec.
2025-06-25 16:11:13 02801_backup_native_copy: [ OK ] 3.18 sec.
2025-06-25 16:11:13 00763_long_lock_buffer_alter_destination_table: [ OK ] 31.10 sec.
2025-06-25 16:11:13 01272_suspicious_codecs: [ OK ] 0.47 sec.
2025-06-25 16:11:13 03263_analyzer_materialized_view_cte_nested: [ OK ] 0.27 sec.
2025-06-25 16:11:13 02122_parallel_formatting_JSONCompact: [ OK ] 1.52 sec.
2025-06-25 16:11:14 00007_array: [ OK ] 0.22 sec.
2025-06-25 16:11:14 01748_partition_id_pruning: [ OK ] 0.32 sec.
2025-06-25 16:11:14 03003_analyzer_setting: [ OK ] 0.22 sec.
2025-06-25 16:11:14 02254_projection_broken_part: [ OK ] 3.68 sec.
2025-06-25 16:11:14 01940_custom_tld_sharding_key: [ OK ] 0.22 sec.
2025-06-25 16:11:14 00411_long_accurate_number_comparison_int4: [ OK ] 3.48 sec.
2025-06-25 16:11:14 03230_anyHeavy_merge: [ OK ] 0.22 sec.
2025-06-25 16:11:14 01386_negative_float_constant_key_condition: [ OK ] 0.32 sec.
2025-06-25 16:11:14 02167_format_from_file_extension: [ OK ] 8.85 sec.
2025-06-25 16:11:14 02366_kql_create_table: [ OK ] 0.27 sec.
2025-06-25 16:11:14 02476_analyzer_join_with_unused_columns: [ OK ] 0.22 sec.
2025-06-25 16:11:14 01106_const_fixed_string_like: [ OK ] 0.32 sec.
2025-06-25 16:11:14 02017_columns_with_dot_2: [ OK ] 0.22 sec.
2025-06-25 16:11:14 03247_generic_arrayMin_arrayMax_fixes: [ OK ] 0.32 sec.
2025-06-25 16:11:14 02915_sleep_large_uint: [ OK ] 0.27 sec.
2025-06-25 16:11:14 01746_test_for_tupleElement_must_be_constant_issue: [ OK ] 0.37 sec.
2025-06-25 16:11:15 00701_join_default_strictness: [ OK ] 0.27 sec.
2025-06-25 16:11:15 01780_column_sparse_pk: [ OK ] 0.37 sec.
2025-06-25 16:11:15 02125_dict_get_type_nullable_fix: [ OK ] 0.27 sec.
2025-06-25 16:11:15 03205_json_cast_from_string: [ OK ] 0.37 sec.
2025-06-25 16:11:15 01076_json_each_row_array: [ OK ] 0.62 sec.
2025-06-25 16:11:15 01710_projection_with_ast_rewrite_settings: [ OK ] 0.32 sec.
2025-06-25 16:11:15 01085_simdjson_uint64: [ OK ] 0.22 sec.
2025-06-25 16:11:15 03038_nested_dynamic_merges_small: [ OK ] 0.98 sec.
2025-06-25 16:11:15 02113_format_row: [ OK ] 0.22 sec.
2025-06-25 16:11:15 00422_hash_function_constexpr: [ OK ] 0.22 sec.
2025-06-25 16:11:15 03321_functions_to_subcolumns_skip_index: [ OK ] 0.27 sec.
2025-06-25 16:11:15 02011_normalize_utf8: [ OK ] 0.37 sec.
2025-06-25 16:11:15 02251_last_day_of_month: [ OK ] 0.27 sec.
2025-06-25 16:11:15 02478_analyzer_table_expression_aliases: [ OK ] 0.28 sec.
2025-06-25 16:11:15 01186_conversion_to_nullable: [ OK ] 0.27 sec.
2025-06-25 16:11:16 00321_pk_set: [ OK ] 0.32 sec.
2025-06-25 16:11:16 00732_quorum_insert_simple_test_1_parts_zookeeper_long: [ OK ] 0.42 sec.
2025-06-25 16:11:16 01553_datetime64_comparison: [ OK ] 0.22 sec.
2025-06-25 16:11:16 02184_storage_add_support_ttl: [ OK ] 0.32 sec.
2025-06-25 16:11:16 01102_distributed_local_in_bug: [ OK ] 0.27 sec.
2025-06-25 16:11:16 01666_date_lut_buffer_overflow: [ OK ] 0.22 sec.
2025-06-25 16:11:16 02478_window_frame_type_groups: [ OK ] 0.22 sec.
2025-06-25 16:11:16 00825_protobuf_format_squares: [ OK ] 1.38 sec.
2025-06-25 16:11:16 02515_analyzer_null_for_empty: [ OK ] 0.22 sec.
2025-06-25 16:11:16 03011_adaptative_timeout_compatibility: [ OK ] 0.22 sec.
2025-06-25 16:11:16 01030_limit_by_with_ties_error: [ OK ] 1.07 sec.
2025-06-25 16:11:16 01719_join_timezone: [ OK ] 0.32 sec.
2025-06-25 16:11:16 02871_clickhouse_client_restart_pager: [ OK ] 0.62 sec.
2025-06-25 16:11:17 00661_optimize_final_replicated_without_partition_zookeeper: [ OK ] 0.42 sec.
2025-06-25 16:11:17 02275_full_sort_join_long: [ SKIPPED ] 0.00 sec.
2025-06-25 16:11:17 Reason: not running for current build
2025-06-25 16:11:17 01492_format_readable_quantity: [ OK ] 0.22 sec.
2025-06-25 16:11:17 02267_empty_arrays_read_reverse: [ OK ] 0.47 sec.
2025-06-25 16:11:17 02790_client_max_opening_fd: [ OK ] 0.62 sec.
2025-06-25 16:11:17 00620_optimize_on_nonleader_replica_zookeeper: [ OK ] 0.37 sec.
2025-06-25 16:11:17 03153_format_regexp_usability: [ OK ] 0.82 sec.
2025-06-25 16:11:17 01891_not_like_partition_prune: [ OK ] 0.27 sec.
2025-06-25 16:11:17 01521_alter_enum_and_reverse_read: [ OK ] 0.22 sec.
2025-06-25 16:11:17 01456_modify_column_type_via_add_drop_update: [ OK ] 0.52 sec.
2025-06-25 16:11:18 01123_parse_date_time_best_effort_even_more: [ OK ] 0.22 sec.
2025-06-25 16:11:18 01901_in_literal_shard_prune: [ OK ] 0.27 sec.
2025-06-25 16:11:18 02687_native_fuzz: [ OK ] 0.22 sec.
2025-06-25 16:11:18 00834_limit_with_constant_expressions: [ OK ] 0.32 sec.
2025-06-25 16:11:18 02236_json_each_row_empty_map_schema_inference: [ OK ] 0.22 sec.
2025-06-25 16:11:18 00102_insert_into_temporary_table: [ OK ] 0.22 sec.
2025-06-25 16:11:18 02374_in_tuple_index: [ OK ] 0.27 sec.
2025-06-25 16:11:18 03196_max_intersections_arena_crash: [ OK ] 0.22 sec.
2025-06-25 16:11:18 01291_distributed_low_cardinality_memory_efficient: [ OK ] 0.28 sec.
2025-06-25 16:11:18 00829_bitmap64_function: [ OK ] 0.37 sec.
2025-06-25 16:11:18 01662_test_toDayOfMonth_mysql_compatibility: [ OK ] 0.22 sec.
2025-06-25 16:11:19 02518_delete_on_materialized_view: [ OK ] 0.27 sec.
2025-06-25 16:11:19 01531_query_log_query_comment: [ OK ] 0.87 sec.
2025-06-25 16:11:19 02766_prql: [ OK ] 1.64 sec.
2025-06-25 16:11:19 01293_client_interactive_vertical_singleline: [ OK ] 0.62 sec.
2025-06-25 16:11:19 02025_storage_filelog_virtual_col: [ OK ] 3.53 sec.
2025-06-25 16:11:19 03033_tupleIntXYZ_and_tupleModulo: [ OK ] 0.47 sec.
2025-06-25 16:11:19 02340_union_header: [ OK ] 0.22 sec.
2025-06-25 16:11:19 01632_max_partitions_to_read: [ OK ] 0.27 sec.
2025-06-25 16:11:20 02451_variadic_null_garbage_data: [ OK ] 0.32 sec.
2025-06-25 16:11:20 02233_with_total_empty_chunk: [ OK ] 0.22 sec.
2025-06-25 16:11:20 02597_column_delete_and_replication: [ OK ] 1.33 sec.
2025-06-25 16:11:20 02860_distributed_flush_on_detach: [ OK ] 0.27 sec.
2025-06-25 16:11:20 02009_array_join_partition: [ OK ] 0.22 sec.
2025-06-25 16:11:20 01559_aggregate_null_for_empty_fix: [ OK ] 0.27 sec.
2025-06-25 16:11:20 00800_low_cardinality_distributed_insert: [ OK ] 0.22 sec.
2025-06-25 16:11:20 03032_storage_memory_modify_settings: [ OK ] 0.42 sec.
2025-06-25 16:11:20 00098_shard_i_union_all: [ OK ] 0.32 sec.
2025-06-25 16:11:21 02841_parallel_replicas_summary: [ OK ] 1.17 sec.
2025-06-25 16:11:21 01409_topK_merge: [ OK ] 0.27 sec.
2025-06-25 16:11:21 01440_big_int_exotic_casts: [ OK ] 0.53 sec.
2025-06-25 16:11:21 02921_file_engine_size_virtual_column: [ OK ] 0.82 sec.
2025-06-25 16:11:21 03243_create_or_replace_view_dependency_check: [ OK ] 0.22 sec.
2025-06-25 16:11:21 02371_create_temporary_table_as_with_columns_list: [ OK ] 0.23 sec.
2025-06-25 16:11:21 00609_prewhere_and_default: [ OK ] 0.57 sec.
2025-06-25 16:11:21 01053_if_chain_check: [ OK ] 0.27 sec.
2025-06-25 16:11:21 03199_has_lc_fixed_string: [ OK ] 0.22 sec.
2025-06-25 16:11:21 01518_select_in_null: [ OK ] 0.67 sec.
2025-06-25 16:11:22 03057_analyzer_subquery_alias_join: [ OK ] 0.22 sec.
2025-06-25 16:11:22 02477_logical_expressions_optimizer_low_cardinality: [ OK ] 0.32 sec.
2025-06-25 16:11:22 01914_ubsan_quantile_timing: [ OK ] 0.22 sec.
2025-06-25 16:11:22 02470_suspicious_low_cardinality_msan: [ OK ] 0.27 sec.
2025-06-25 16:11:23 00215_primary_key_order_zookeeper_long: [ OK ] 0.33 sec.
2025-06-25 16:11:23 02207_s3_content_type: [ OK ] 1.02 sec.
2025-06-25 16:11:23 02494_array_function_range: [ OK ] 0.27 sec.
2025-06-25 16:11:23 01476_right_full_join_switch: [ OK ] 0.37 sec.
2025-06-25 16:11:23 00141_parse_timestamp_as_datetime: [ OK ] 0.27 sec.
2025-06-25 16:11:23 00972_geohashesInBox: [ OK ] 0.52 sec.
2025-06-25 16:11:24 00725_join_on_bug_1: [ OK ] 0.27 sec.
2025-06-25 16:11:24 02122_parallel_formatting_PrettyCompactNoEscapes: [ OK ] 2.43 sec.
2025-06-25 16:11:24 01532_having_with_totals: [ OK ] 0.32 sec.
2025-06-25 16:11:24 02496_remove_redundant_sorting_analyzer: [ OK ] 7.79 sec.
2025-06-25 16:11:24 01436_storage_merge_with_join_push_down: [ OK ] 0.27 sec.
2025-06-25 16:11:24 00515_shard_desc_table_functions_and_subqueries: [ OK ] 0.27 sec.
2025-06-25 16:11:24 02922_respect_nulls_parser: [ OK ] 0.37 sec.
2025-06-25 16:11:24 01720_union_distinct_with_limit: [ OK ] 0.22 sec.
2025-06-25 16:11:24 02392_every_setting_must_have_documentation: [ OK ] 0.22 sec.
2025-06-25 16:11:24 03006_buffer_overflow_join: [ OK ] 0.22 sec.
2025-06-25 16:11:25 01442_h3kring_range_check: [ OK ] 0.27 sec.
2025-06-25 16:11:25 03199_unbin_buffer_overflow: [ OK ] 5.23 sec.
2025-06-25 16:11:25 00311_array_primary_key: [ OK ] 0.37 sec.
2025-06-25 16:11:25 02864_replace_regexp_string_fallback: [ OK ] 0.27 sec.
2025-06-25 16:11:25 00084_summing_merge_tree: [ OK ] 0.32 sec.
2025-06-25 16:11:25 00086_concat_nary_const_with_nonconst_segfault: [ OK ] 0.47 sec.
2025-06-25 16:11:25 03158_dynamic_type_from_variant: [ OK ] 0.27 sec.
2025-06-25 16:11:25 00600_create_temporary_table_if_not_exists: [ OK ] 0.22 sec.
2025-06-25 16:11:25 02149_issue_32487: [ OK ] 0.22 sec.
2025-06-25 16:11:26 01560_optimize_on_insert_zookeeper: [ OK ] 0.32 sec.
2025-06-25 16:11:26 02800_transform_alter: [ OK ] 0.32 sec.
2025-06-25 16:11:26 02113_base64encode_trailing_bytes_1: [ OK ] 0.22 sec.
2025-06-25 16:11:26 02047_log_family_complex_structs_data_file_dumps: [ OK ] 4.58 sec.
2025-06-25 16:11:26 00688_low_cardinality_alter_add_column: [ OK ] 0.27 sec.
2025-06-25 16:11:26 01549_low_cardinality_mv_fuzz: [ OK ] 0.22 sec.
2025-06-25 16:11:26 02354_numeric_literals_with_underscores: [ OK ] 0.27 sec.
2025-06-25 16:11:26 02006_todatetime64_from_string: [ OK ] 0.32 sec.
2025-06-25 16:11:26 00003_reinterpret_as_string: [ OK ] 0.22 sec.
2025-06-25 16:11:26 02016_summing_mt_aggregating_column: [ OK ] 0.27 sec.
2025-06-25 16:11:26 00882_multiple_join_no_alias: [ OK ] 0.32 sec.
2025-06-25 16:11:27 00120_join_and_group_by: [ OK ] 0.22 sec.
2025-06-25 16:11:27 01277_large_tuples: [ OK ] 0.27 sec.
2025-06-25 16:11:27 02100_now64_types_bug: [ OK ] 0.22 sec.
2025-06-25 16:11:27 02021_h3_is_res_classIII: [ OK ] 0.29 sec.
2025-06-25 16:11:27 02886_binary_like: [ OK ] 0.32 sec.
2025-06-25 16:11:27 02477_s3_request_throttler: [ OK ] 2.32 sec.
2025-06-25 16:11:27 01307_polygon_perimeter: [ OK ] 0.27 sec.
2025-06-25 16:11:28 01273_lc_fixed_string_field: [ OK ] 0.32 sec.
2025-06-25 16:11:28 02706_kolmogorov_smirnov_test: [ OK ] 0.37 sec.
2025-06-25 16:11:28 01610_client_spawn_editor: [ OK ] 0.12 sec.
2025-06-25 16:11:28 03036_reading_s3_archives: [ OK ] 0.72 sec.
2025-06-25 16:11:28 01122_totals_rollup_having_block_header: [ OK ] 0.27 sec.
2025-06-25 16:11:28 01938_joins_identifiers: [ OK ] 0.27 sec.
2025-06-25 16:11:28 02250_lots_of_columns_in_csv_with_names: [ OK ] 1.47 sec.
2025-06-25 16:11:28 01753_optimize_aggregation_in_order: [ OK ] 0.67 sec.
2025-06-25 16:11:28 02367_analyzer_table_alias_columns: [ OK ] 0.32 sec.
2025-06-25 16:11:28 02306_window_move_row_number_fix: [ OK ] 0.22 sec.
2025-06-25 16:11:29 02807_lower_utf8_msan: [ OK ] 0.27 sec.
2025-06-25 16:11:29 02982_create_mv_inner_extra: [ OK ] 0.27 sec.
2025-06-25 16:11:29 01585_fuzz_bits_with_bugfix: [ OK ] 0.27 sec.
2025-06-25 16:11:29 03261_test_merge_parquet_bloom_filter_minmax_stats: [ OK ] 0.87 sec.
2025-06-25 16:11:29 03087_analyzer_subquery_with_alias: [ OK ] 0.32 sec.
2025-06-25 16:11:29 02891_functions_over_sparse_columns: [ OK ] 0.27 sec.
2025-06-25 16:11:30 00098_a_union_all: [ OK ] 0.22 sec.
2025-06-25 16:11:30 02661_quantile_approx: [ OK ] 0.52 sec.
2025-06-25 16:11:30 02326_numbers_from_json_strings_schema_inference: [ OK ] 0.28 sec.
2025-06-25 16:11:31 00763_create_query_as_table_engine_bug: [ OK ] 0.27 sec.
2025-06-25 16:11:31 01346_alter_enum_partition_key_replicated_zookeeper_long: [ OK ] 0.57 sec.
2025-06-25 16:11:31 00298_enum_width_and_cast: [ OK ] 0.27 sec.
2025-06-25 16:11:32 02500_remove_redundant_distinct_analyzer: [ OK ] 8.19 sec.
2025-06-25 16:11:32 02029_test_implemented_methods: [ OK ] 0.47 sec.
2025-06-25 16:11:32 02863_mutation_where_in_set_result_cache_pipeline_stuck_bug: [ OK ] 0.27 sec.
2025-06-25 16:11:33 03222_json_squashing: [ OK ] 0.83 sec.
2025-06-25 16:11:33 02843_backup_use_same_s3_credentials_for_base_backup: [ OK ] 4.08 sec.
2025-06-25 16:11:33 00607_index_in_in: [ OK ] 0.27 sec.
2025-06-25 16:11:33 03161_cnf_reduction: [ OK ] 0.32 sec.
2025-06-25 16:11:34 01013_totals_without_aggregation: [ OK ] 0.27 sec.
2025-06-25 16:11:34 02911_arrow_large_list: [ OK ] 0.52 sec.
2025-06-25 16:11:34 01099_operators_date_and_timestamp: [ OK ] 0.62 sec.
2025-06-25 16:11:34 01472_toBoundsOfInterval_disallow_empty_tz_field: [ OK ] 0.52 sec.
2025-06-25 16:11:35 01471_with_format: [ OK ] 0.27 sec.
2025-06-25 16:11:35 02267_join_dup_columns_issue36199: [ OK ] 0.37 sec.
2025-06-25 16:11:35 03208_array_of_json_read_subcolumns_2_compact_merge_tree: [ SKIPPED ] 0.00 sec.
2025-06-25 16:11:35 Reason: not running for current build
2025-06-25 16:11:37 02697_stop_reading_on_first_cancel: [ OK ] 1.53 sec.
2025-06-25 16:11:37 00284_external_aggregation_2: [ OK ] 4.79 sec.
2025-06-25 16:11:37 01318_map_populate_series: [ OK ] 0.47 sec.
2025-06-25 16:11:37 00910_buffer_prewhere: [ OK ] 0.33 sec.
2025-06-25 16:11:38 01680_predicate_pushdown_union_distinct_subquery: [ OK ] 0.29 sec.
2025-06-25 16:11:38 02049_lowcardinality_shortcircuit_crash: [ OK ] 0.33 sec.
2025-06-25 16:11:38 00653_verification_monotonic_data_load: [ OK ] 9.04 sec.
2025-06-25 16:11:38 00307_format_xml: [ OK ] 0.27 sec.
2025-06-25 16:11:38 02304_grouping_set_order_by: [ OK ] 0.33 sec.
2025-06-25 16:11:39 01514_parallel_formatting: [ OK ] 1.83 sec.
2025-06-25 16:11:39 01041_h3_is_valid: [ OK ] 0.27 sec.
2025-06-25 16:11:39 03290_final_collapsing: [ OK ] 0.32 sec.
2025-06-25 16:11:39 03039_dynamic_aggregating_merge_tree: [ OK ] 10.89 sec.
2025-06-25 16:11:39 00623_replicated_truncate_table_zookeeper_long: [ OK ] 0.37 sec.
2025-06-25 16:11:39 02176_dict_get_has_implicit_key_cast: [ OK ] 0.47 sec.
2025-06-25 16:11:39 02789_jit_cannot_convert_column: [ OK ] 0.27 sec.
2025-06-25 16:11:39 02579_fill_empty_chunk_analyzer: [ OK ] 0.33 sec.
2025-06-25 16:11:40 01245_limit_infinite_sources: [ OK ] 0.82 sec.
2025-06-25 16:11:40 02071_lower_upper_utf8_row_overlaps: [ OK ] 0.27 sec.
2025-06-25 16:11:40 02184_range_hashed_dictionary_outside_range_values: [ OK ] 0.32 sec.
2025-06-25 16:11:40 02311_normalize_utf8_constant: [ OK ] 0.23 sec.
2025-06-25 16:11:40 02711_trim_aliases: [ OK ] 0.32 sec.
2025-06-25 16:11:40 01070_h3_to_parent: [ OK ] 0.22 sec.
2025-06-25 16:11:40 00500_point_in_polygon: [ OK ] 0.42 sec.
2025-06-25 16:11:40 01778_where_with_column_name: [ OK ] 0.27 sec.
2025-06-25 16:11:41 01414_low_cardinality_nullable: [ OK ] 1.33 sec.
2025-06-25 16:11:41 03274_format_inference_create_query_file: [ OK ] 0.97 sec.
2025-06-25 16:11:42 03031_filter_float64_logical_error: [ OK ] 0.27 sec.
2025-06-25 16:11:42 01926_union_all_schmak: [ OK ] 0.28 sec.
2025-06-25 16:11:42 02841_not_ready_set_bug: [ OK ] 2.24 sec.
2025-06-25 16:11:42 02155_dictionary_comment: [ OK ] 0.37 sec.
2025-06-25 16:11:42 00666_uniq_complex_types: [ OK ] 0.47 sec.
2025-06-25 16:11:43 02352_interactive_queries_from_file: [ OK ] 0.72 sec.
2025-06-25 16:11:43 02042_map_get_non_const_key: [ OK ] 0.22 sec.
2025-06-25 16:11:43 03221_mutate_profile_events: [ OK ] 0.87 sec.
2025-06-25 16:11:43 03215_grant_current_grants: [ OK ] 2.52 sec.
2025-06-25 16:11:43 02240_asof_join_biginteger: [ OK ] 0.27 sec.
2025-06-25 16:11:44 01264_nested_baloo_bear: [ OK ] 0.27 sec.
2025-06-25 16:11:44 02306_rowbinary_has_no_bom: [ OK ] 0.48 sec.
2025-06-25 16:11:44 01135_default_and_alter_zookeeper: [ OK ] 0.27 sec.
2025-06-25 16:11:45 00968_roundAge: [ OK ] 0.27 sec.
2025-06-25 16:11:45 01825_type_json_nbagames: [ OK ] 4.94 sec.
2025-06-25 16:11:46 02030_rocksdb_race_long: [ OK ] 20.89 sec.
2025-06-25 16:11:46 02421_type_json_async_insert: [ OK ] 2.38 sec.
2025-06-25 16:11:46 02900_issue_55858: [ OK ] 0.37 sec.
2025-06-25 16:11:46 02244_make_datetime: [ OK ] 0.53 sec.
2025-06-25 16:11:46 01060_defaults_all_columns: [ OK ] 0.27 sec.
2025-06-25 16:11:47 01945_show_debug_warning: [ OK ] 1.98 sec.
2025-06-25 16:11:47 00953_constraints_operations: [ OK ] 3.09 sec.
2025-06-25 16:11:47 00746_sql_fuzzy: [ OK ] 96.82 sec.
2025-06-25 16:11:47 00411_merge_tree_where_const_in_set: [ OK ] 0.27 sec.
2025-06-25 16:11:47 02125_transform_decimal_bug: [ OK ] 0.27 sec.
2025-06-25 16:11:47 02995_index_9: [ SKIPPED ] 0.00 sec.
2025-06-25 16:11:47 Reason: not running for current build
2025-06-25 16:11:47 01374_if_nullable_filimonov: [ OK ] 0.23 sec.
2025-06-25 16:11:47 02842_one_input_format: [ OK ] 1.73 sec.
2025-06-25 16:11:47 03210_optimize_rewrite_aggregate_function_with_if_return_type_bug: [ OK ] 0.32 sec.
2025-06-25 16:11:47 01318_alter_add_column_exists: [ OK ] 0.22 sec.
2025-06-25 16:11:48 02882_formatQuery: [ OK ] 0.42 sec.
2025-06-25 16:11:48 01710_projection_optimize_materialize: [ OK ] 0.53 sec.
2025-06-25 16:11:48 03215_parallel_replicas_crash_after_refactoring: [ OK ] 0.27 sec.
2025-06-25 16:11:49 00618_nullable_in: [ OK ] 0.32 sec.
2025-06-25 16:11:49 02112_delayed_clickhouse_local: [ OK ] 0.57 sec.
2025-06-25 16:11:49 00825_protobuf_format_skipped_column_in_nested: [ OK ] 1.58 sec.
2025-06-25 16:11:50 01665_substring_ubsan: [ OK ] 0.27 sec.
2025-06-25 16:11:50 02376_analyzer_in_function_subquery: [ OK ] 0.32 sec.
2025-06-25 16:11:50 01170_alter_partition_isolation: [ OK ] 2.93 sec.
2025-06-25 16:11:51 01710_projection_array_join: [ OK ] 0.27 sec.
2025-06-25 16:11:51 02517_infer_uint64_in_case_of_int64_overflow: [ OK ] 1.57 sec.
2025-06-25 16:11:51 02577_keepermap_delete_update: [ OK ] 0.37 sec.
2025-06-25 16:11:51 02810_fix_remove_dedundant_distinct_view: [ OK ] 0.27 sec.
2025-06-25 16:11:51 00596_limit_on_expanded_ast: [ OK ] 0.62 sec.
2025-06-25 16:11:52 02473_extract_low_cardinality_from_json: [ OK ] 0.22 sec.
2025-06-25 16:11:52 01017_bithamming_distance: [ OK ] 0.27 sec.
2025-06-25 16:11:52 02122_4letter_words_stress_zookeeper: [ OK ] 17.53 sec.
2025-06-25 16:11:52 02146_mv_non_phys: [ OK ] 0.22 sec.
2025-06-25 16:11:52 01018_ambiguous_column: [ OK ] 0.27 sec.
2025-06-25 16:11:52 02324_compatibility_setting: [ OK ] 2.07 sec.
2025-06-25 16:11:52 03094_one_thousand_joins: [ OK ] 6.44 sec.
2025-06-25 16:11:52 02111_with_fill_no_rows: [ OK ] 0.22 sec.
2025-06-25 16:11:52 02158_proportions_ztest: [ OK ] 0.27 sec.
2025-06-25 16:11:53 02902_add_scalar_in_all_case: [ OK ] 0.27 sec.
2025-06-25 16:11:53 01710_order_by_projections_incomplete: [ OK ] 0.28 sec.
2025-06-25 16:11:53 01043_dictionary_attribute_properties_values: [ OK ] 0.27 sec.
2025-06-25 16:11:53 00009_array_join_subquery: [ OK ] 0.22 sec.
2025-06-25 16:11:53 01605_key_condition_enum_int: [ OK ] 0.27 sec.
2025-06-25 16:11:54 02122_parallel_formatting_TSV: [ OK ] 1.52 sec.
2025-06-25 16:11:54 01058_zlib_ng_level1_bug: [ OK ] 1.62 sec.
2025-06-25 16:11:54 01390_remove_injective_in_uniq: [ OK ] 0.32 sec.
2025-06-25 16:11:55 01273_arrow_load: [ OK ] 1.47 sec.
2025-06-25 16:11:55 02409_url_format_detection: [ OK ] 0.62 sec.
2025-06-25 16:11:55 00131_set_hashed: [ OK ] 0.28 sec.
2025-06-25 16:11:56 00752_low_cardinality_left_array_join: [ OK ] 0.27 sec.
2025-06-25 16:11:56 00534_functions_bad_arguments8: [ SKIPPED ] 0.00 sec.
2025-06-25 16:11:56 Reason: not running for current build
2025-06-25 16:11:56 03033_analyzer_resolve_from_parent_scope: [ OK ] 0.32 sec.
2025-06-25 16:11:58 02476_analyzer_identifier_hints: [ OK ] 11.16 sec.
2025-06-25 16:11:58 01509_check_many_parallel_quorum_inserts_long: [ OK ] 4.83 sec.
2025-06-25 16:11:58 01088_array_slice_of_aggregate_functions: [ OK ] 0.22 sec.
2025-06-25 16:11:58 03273_dictionary_rbac: [ OK ] 1.82 sec.
2025-06-25 16:11:58 00360_to_date_from_string_with_datetime: [ OK ] 0.27 sec.
2025-06-25 16:11:58 03113_analyzer_not_found_column_in_block_2: [ OK ] 0.27 sec.
2025-06-25 16:11:58 02981_variant_type_function: [ OK ] 0.27 sec.
2025-06-25 16:11:58 01182_materialized_view_different_structure: [ OK ] 0.47 sec.
2025-06-25 16:11:59 01852_s2_get_neighbours: [ OK ] 0.22 sec.
2025-06-25 16:11:59 01835_alias_to_primary_key_cyfdecyf: [ OK ] 0.27 sec.
2025-06-25 16:11:59 00668_compare_arrays_silviucpp: [ OK ] 0.22 sec.
2025-06-25 16:11:59 01040_h3_get_resolution: [ OK ] 0.22 sec.
2025-06-25 16:12:00 00825_protobuf_format_splitted_nested: [ OK ] 1.44 sec.
2025-06-25 16:12:00 01323_if_with_nulls: [ OK ] 0.37 sec.
2025-06-25 16:12:01 02457_csv_parse_date_out_of_range: [ OK ] 1.32 sec.
2025-06-25 16:12:01 02889_print_pretty_type_names: [ OK ] 0.22 sec.
2025-06-25 16:12:02 00563_shard_insert_into_remote: [ OK ] 0.32 sec.
2025-06-25 16:12:02 02294_floating_point_second_in_settings: [ OK ] 4.08 sec.
2025-06-25 16:12:02 02313_cross_join_dup_col_names: [ OK ] 0.22 sec.
2025-06-25 16:12:02 00534_exp10: [ OK ] 0.22 sec.
2025-06-25 16:12:02 01472_many_rows_in_totals: [ OK ] 0.27 sec.
2025-06-25 16:12:03 03161_ipv4_ipv6_equality: [ OK ] 0.32 sec.
2025-06-25 16:12:03 02588_avro_date32_and_decimals: [ OK ] 0.92 sec.
2025-06-25 16:12:03 00952_basic_constraints: [ OK ] 3.28 sec.
2025-06-25 16:12:03 02560_regexp_denial_of_service: [ OK ] 0.57 sec.
2025-06-25 16:12:03 01846_alter_column_without_type_bugfix: [ OK ] 0.22 sec.
2025-06-25 16:12:03 02814_ReplacingMergeTree_fix_select_final_on_single_partition: [ OK ] 0.27 sec.
2025-06-25 16:12:03 01772_to_start_of_hour_align: [ OK ] 0.27 sec.
2025-06-25 16:12:04 01825_type_json_ghdata_insert_select: [ OK ] 10.05 sec.
2025-06-25 16:12:04 01214_test_storage_merge_aliases_with_where: [ OK ] 0.32 sec.
2025-06-25 16:12:04 00240_replace_substring_loop: [ OK ] 0.62 sec.
2025-06-25 16:12:04 02206_format_override: [ OK ] 0.92 sec.
2025-06-25 16:12:05 00616_final_single_part: [ OK ] 0.32 sec.
2025-06-25 16:12:05 02245_make_datetime64: [ OK ] 0.62 sec.
2025-06-25 16:12:05 02534_join_prewhere_bug: [ OK ] 0.32 sec.
2025-06-25 16:12:05 00507_array_no_params: [ OK ] 0.97 sec.
2025-06-25 16:12:05 02033_join_engine_deadlock_long: [ OK ] 1.73 sec.
2025-06-25 16:12:05 02751_multiif_to_if_crash: [ OK ] 0.27 sec.
2025-06-25 16:12:05 01866_datetime64_cmp_with_constant: [ OK ] 0.37 sec.
2025-06-25 16:12:06 02560_count_digits: [ OK ] 0.27 sec.
2025-06-25 16:12:06 00500_point_in_polygon_non_const_poly: [ OK ] 0.67 sec.
2025-06-25 16:12:06 02737_sql_auto_is_null: [ OK ] 0.22 sec.
2025-06-25 16:12:07 02112_delayed_clickhouse_client_with_queries_file: [ OK ] 0.62 sec.
2025-06-25 16:12:07 01825_type_json_schema_inference: [ OK ] 2.32 sec.
2025-06-25 16:12:08 02001_append_output_file: [ OK ] 0.62 sec.
2025-06-25 16:12:08 03034_ddls_and_merges_with_unusual_maps: [ OK ] 0.32 sec.
2025-06-25 16:12:09 00276_sample: [ OK ] 1.27 sec.
2025-06-25 16:12:09 02901_remove_nullable_crash_analyzer: [ OK ] 0.27 sec.
2025-06-25 16:12:09 02565_update_empty_nested: [ OK ] 0.37 sec.
2025-06-25 16:12:09 02421_simple_queries_for_opentelemetry: [ OK ] 4.08 sec.
2025-06-25 16:12:10 00936_function_result_with_operator_in: [ OK ] 0.32 sec.
2025-06-25 16:12:10 02843_context_has_expired: [ OK ] 0.32 sec.
2025-06-25 16:12:10 03207_json_read_subcolumns_2_wide_merge_tree: [ SKIPPED ] 0.00 sec.
2025-06-25 16:12:10 Reason: not running for current build
2025-06-25 16:12:10 00810_in_operators_segfault: [ OK ] 0.22 sec.
2025-06-25 16:12:10 02514_bad_index_granularity: [ OK ] 0.22 sec.
2025-06-25 16:12:10 02315_readonly_create_function: [ OK ] 0.62 sec.
2025-06-25 16:12:10 00904_array_with_constant_2: [ OK ] 0.22 sec.
2025-06-25 16:12:11 00738_lock_for_inner_table: [ OK ] 16.14 sec.
2025-06-25 16:12:11 02181_format_describe_query: [ OK ] 0.42 sec.
2025-06-25 16:12:11 01940_totimezone_operator_monotonicity: [ OK ] 0.32 sec.
2025-06-25 16:12:12 00662_has_nullable: [ OK ] 0.32 sec.
2025-06-25 16:12:12 02592_avro_more_types: [ OK ] 0.72 sec.
2025-06-25 16:12:12 01657_array_element_ubsan: [ OK ] 0.33 sec.
2025-06-25 16:12:12 03211_nested_json_merges: [ OK ] 20.83 sec.
2025-06-25 16:12:12 02972_to_string_nullable_timezone: [ OK ] 0.28 sec.
2025-06-25 16:12:13 02178_column_function_insert_from: [ OK ] 0.27 sec.
2025-06-25 16:12:14 00632_get_sample_block_cache: [ OK ] 1.89 sec.
2025-06-25 16:12:14 02903_bug_43644: [ OK ] 0.28 sec.
2025-06-25 16:12:15 02241_parquet_bad_column: [ OK ] 3.09 sec.
2025-06-25 16:12:16 01825_new_type_json_8: [ OK ] 3.34 sec.
2025-06-25 16:12:16 01448_json_compact_strings_each_row: [ OK ] 0.78 sec.
2025-06-25 16:12:16 00552_logical_functions_uint8_as_bool: [ OK ] 0.32 sec.
2025-06-25 16:12:17 02922_respect_nulls_extensive: [ OK ] 0.58 sec.
2025-06-25 16:12:17 01925_jit_aggregation_function_count_long: [ OK ] 0.32 sec.
2025-06-25 16:12:17 02374_combine_multi_if_and_count_if_opt: [ OK ] 0.27 sec.
2025-06-25 16:12:17 02473_multistep_split_prewhere: [ OK ] 12.21 sec.
2025-06-25 16:12:17 02967_parallel_replicas_join_algo_and_analyzer_1: [ OK ] 3.40 sec.
2025-06-25 16:12:17 02574_suspicious_low_cardinality_msan: [ OK ] 0.40 sec.
2025-06-25 16:12:18 00380_client_break_at_exception_in_batch_mode: [ OK ] 0.82 sec.
2025-06-25 16:12:18 01551_mergetree_read_in_order_spread: [ OK ] 0.33 sec.
2025-06-25 16:12:18 01308_row_policy_and_trivial_count_query: [ OK ] 0.32 sec.
2025-06-25 16:12:18 01199_url_functions_path_without_schema_yiurule: [ OK ] 0.27 sec.
2025-06-25 16:12:18 00823_sequence_match_dfa: [ OK ] 0.89 sec.
2025-06-25 16:12:18 01119_session_log: [ OK ] 31.87 sec.
2025-06-25 16:12:19 03215_multilinestring_geometry: [ OK ] 0.32 sec.
2025-06-25 16:12:19 03156_group_concat: [ OK ] 0.53 sec.
2025-06-25 16:12:19 02381_client_prints_server_side_time: [ SKIPPED ] 0.00 sec.
2025-06-25 16:12:19 Reason: not running for current build
2025-06-25 16:12:19 02770_jit_aggregation_nullable_key_fix: [ OK ] 0.47 sec.
2025-06-25 16:12:19 00090_union_race_conditions_1: [ OK ] 10.57 sec.
2025-06-25 16:12:19 01770_add_months_ubsan: [ OK ] 0.22 sec.
2025-06-25 16:12:19 00603_system_parts_nonexistent_database: [ OK ] 0.22 sec.
2025-06-25 16:12:19 02918_optimize_count_for_merge_tables: [ OK ] 0.32 sec.
2025-06-25 16:12:19 01051_new_any_join_engine: [ OK ] 0.52 sec.
2025-06-25 16:12:19 00041_aggregation_remap: [ OK ] 0.27 sec.
2025-06-25 16:12:19 01831_max_streams: [ OK ] 0.27 sec.
2025-06-25 16:12:19 01399_http_request_headers: [ OK ] 0.67 sec.
2025-06-25 16:12:20 00234_disjunctive_equality_chains_optimization: [ OK ] 0.27 sec.
2025-06-25 16:12:20 01097_pre_limit: [ OK ] 0.27 sec.
2025-06-25 16:12:20 01293_pretty_max_value_width: [ OK ] 0.37 sec.
2025-06-25 16:12:20 01497_now_support_timezone: [ OK ] 0.28 sec.
2025-06-25 16:12:20 01621_sort_after_join_pipeline_stuck: [ OK ] 0.27 sec.
2025-06-25 16:12:20 02920_alter_column_of_projections: [ OK ] 0.37 sec.
2025-06-25 16:12:20 03008_uniq_exact_equal_ranges: [ OK ] 1.73 sec.
2025-06-25 16:12:20 02041_test_fuzzy_alter: [ OK ] 0.28 sec.
2025-06-25 16:12:21 01062_pm_multiple_all_join_same_value: [ OK ] 0.27 sec.
2025-06-25 16:12:21 01045_array_zip: [ OK ] 0.32 sec.
2025-06-25 16:12:21 02731_nothing_deserialization: [ OK ] 0.27 sec.
2025-06-25 16:12:21 00605_intersections_aggregate_functions: [ OK ] 0.27 sec.
2025-06-25 16:12:21 03197_storage_join_strictness_type_restriction: [ OK ] 0.27 sec.
2025-06-25 16:12:21 02500_analyzer_storage_view_crash_fix: [ OK ] 0.27 sec.
2025-06-25 16:12:21 02124_buffer_with_type_map_long: [ OK ] 10.95 sec.
2025-06-25 16:12:21 02265_per_table_ttl_mutation_on_change: [ OK ] 0.47 sec.
2025-06-25 16:12:22 01070_alter_with_ttl: [ OK ] 0.22 sec.
2025-06-25 16:12:22 02255_broken_parts_chain_on_start: [ OK ] 4.81 sec.
2025-06-25 16:12:22 02454_compressed_marks_in_compact_part: [ OK ] 0.32 sec.
2025-06-25 16:12:22 01825_type_json_in_array: [ OK ] 0.38 sec.
2025-06-25 16:12:22 00969_roundDuration: [ OK ] 0.27 sec.
2025-06-25 16:12:22 01198_client_quota_key: [ OK ] 1.12 sec.
2025-06-25 16:12:22 02366_window_function_order_by: [ OK ] 0.32 sec.
2025-06-25 16:12:22 00872_t64_bit_codec: [ OK ] 1.27 sec.
2025-06-25 16:12:22 01942_dateTimeToSnowflake: [ OK ] 0.47 sec.
2025-06-25 16:12:22 01932_global_in_function: [ OK ] 0.22 sec.
2025-06-25 16:12:23 02457_parse_date_time_best_effort: [ OK ] 0.47 sec.
2025-06-25 16:12:23 02381_parseDateTime64BestEffortUS: [ OK ] 0.32 sec.
2025-06-25 16:12:23 01825_type_json_partitions: [ OK ] 0.32 sec.
2025-06-25 16:12:23 00449_filter_array_nullable_tuple: [ OK ] 0.27 sec.
2025-06-25 16:12:23 01079_order_by_pk: [ OK ] 4.41 sec.
2025-06-25 16:12:23 00134_aggregation_by_fixed_string_of_size_1_2_4_8: [ OK ] 0.27 sec.
2025-06-25 16:12:23 01922_array_join_with_index: [ OK ] 0.27 sec.
2025-06-25 16:12:23 01710_projection_with_nullable_keys: [ OK ] 0.22 sec.
2025-06-25 16:12:23 01804_uniq_up_to_ubsan: [ OK ] 0.22 sec.
2025-06-25 16:12:23 00944_ml_test: [ OK ] 0.32 sec.
2025-06-25 16:12:23 00351_select_distinct_arrays_tuples: [ OK ] 0.27 sec.
2025-06-25 16:12:23 02972_insert_deduplication_token_hierarchical_inserts: [ OK ] 3.58 sec.
2025-06-25 16:12:23 02994_sanity_check_settings: [ OK ] 0.27 sec.
2025-06-25 16:12:24 00676_group_by_in: [ OK ] 0.27 sec.
2025-06-25 16:12:24 00980_full_join_crash_fancyqlx: [ OK ] 0.27 sec.
2025-06-25 16:12:24 00538_datediff_plural_units: [ OK ] 0.32 sec.
2025-06-25 16:12:24 02181_dictionary_attach_detach: [ OK ] 0.32 sec.
2025-06-25 16:12:24 01031_mutations_interpreter_and_context: [ OK ] 1.87 sec.
2025-06-25 16:12:24 01213_alter_rename_nested: [ OK ] 0.27 sec.
2025-06-25 16:12:24 02751_protobuf_ipv6: [ OK ] 0.72 sec.
2025-06-25 16:12:24 01433_hex_float: [ OK ] 0.22 sec.
2025-06-25 16:12:24 01631_date_overflow_as_partition_key: [ OK ] 0.27 sec.
2025-06-25 16:12:24 00802_daylight_saving_time_shift_backwards_at_midnight: [ OK ] 0.27 sec.
2025-06-25 16:12:24 02879_use_structure_from_insertion_table_with_defaults: [ OK ] 0.62 sec.
2025-06-25 16:12:25 01068_parens: [ OK ] 0.22 sec.
2025-06-25 16:12:25 02998_http_redirects: [ OK ] 0.52 sec.
2025-06-25 16:12:25 02539_generate_random_ip: [ OK ] 0.27 sec.
2025-06-25 16:12:25 03456_match_index_prefix_extraction: [ OK ] 0.72 sec.
2025-06-25 16:12:25 03246_alter_update_dynamic_hung: [ OK ] 0.32 sec.
2025-06-25 16:12:25 02864_statistics_predicates: [ OK ] 1.32 sec.
2025-06-25 16:12:26 01379_with_fill_several_columns: [ OK ] 0.27 sec.
2025-06-25 16:12:26 02783_parallel_replicas_trivial_count_optimization: [ OK ] 2.54 sec.
2025-06-25 16:12:26 00149_function_url_hash: [ OK ] 0.27 sec.
2025-06-25 16:12:26 00961_check_table: [ OK ] 0.37 sec.
2025-06-25 16:12:26 03153_dynamic_type_empty: [ OK ] 0.28 sec.
2025-06-25 16:12:27 00700_decimal_null: [ OK ] 0.42 sec.
2025-06-25 16:12:27 01585_use_index_for_global_in: [ OK ] 0.32 sec.
2025-06-25 16:12:27 01032_cityHash64_for_decimal: [ OK ] 0.27 sec.
2025-06-25 16:12:27 00028_shard_big_agg_aj_distributed: [ OK ] 0.32 sec.
2025-06-25 16:12:28 03012_parser_backtracking: [ OK ] 3.73 sec.
2025-06-25 16:12:28 02932_kill_query_sleep: [ OK ] 2.32 sec.
2025-06-25 16:12:28 02980_s3_plain_DROP_TABLE_ReplicatedMergeTree: [ OK ] 1.58 sec.
2025-06-25 16:12:28 00267_tuple_array_access_operators_priority: [ OK ] 0.27 sec.
2025-06-25 16:12:28 02540_duplicate_primary_key2: [ OK ] 0.27 sec.
2025-06-25 16:12:28 01663_quantile_weighted_overflow: [ OK ] 0.22 sec.
2025-06-25 16:12:29 03313_case_insensitive_json_type_declaration: [ OK ] 0.22 sec.
2025-06-25 16:12:29 02490_replacing_merge_tree_is_deleted_column: [ OK ] 1.12 sec.
2025-06-25 16:12:29 01187_set_profile_as_setting: [ OK ] 0.87 sec.
2025-06-25 16:12:29 00931_low_cardinality_nullable_aggregate_function_type: [ OK ] 0.37 sec.
2025-06-25 16:12:29 01776_decrypt_aead_size_check: [ OK ] 0.22 sec.
2025-06-25 16:12:29 02351_Map_combinator_dist: [ OK ] 0.47 sec.
2025-06-25 16:12:29 02260_alter_compact_part_drop_nested_column: [ OK ] 0.37 sec.
2025-06-25 16:12:30 00473_output_format_json_quote_denormals: [ OK ] 1.72 sec.
2025-06-25 16:12:30 02721_parquet_field_not_found: [ OK ] 0.72 sec.
2025-06-25 16:12:30 02995_index_5: [ SKIPPED ] 0.00 sec.
2025-06-25 16:12:30 Reason: not running for current build
2025-06-25 16:12:30 03024_total_rows_approx_is_set_for_system_zeros_and_generate_random: [ OK ] 0.27 sec.
2025-06-25 16:12:31 01622_defaults_for_url_engine: [ OK ] 0.72 sec.
2025-06-25 16:12:31 02895_npy_format: [ OK ] 6.28 sec.
2025-06-25 16:12:31 00098_l_union_all: [ OK ] 0.27 sec.
2025-06-25 16:12:32 02581_share_big_sets_between_mutation_tasks: [ OK ] 6.68 sec.
2025-06-25 16:12:32 01780_range_msan: [ OK ] 0.27 sec.
2025-06-25 16:12:32 00688_low_cardinality_serialization: [ OK ] 1.57 sec.
2025-06-25 16:12:33 02191_parse_date_time_best_effort_more_cases: [ OK ] 0.27 sec.
2025-06-25 16:12:33 01798_uniq_theta_sketch: [ OK ] 0.82 sec.
2025-06-25 16:12:33 02572_max_intersections: [ OK ] 0.27 sec.
2025-06-25 16:12:33 00071_insert_fewer_columns: [ OK ] 0.32 sec.
2025-06-25 16:12:33 00940_order_by_read_in_order: [ OK ] 0.57 sec.
2025-06-25 16:12:33 02122_parallel_formatting_JSONCompactStringsEachRowWithNames: [ OK ] 2.18 sec.
2025-06-25 16:12:34 01580_column_const_comparision: [ OK ] 0.22 sec.
2025-06-25 16:12:34 01358_constexpr_constraint: [ OK ] 0.22 sec.
2025-06-25 16:12:34 03262_udf_in_constraint: [ OK ] 0.72 sec.
2025-06-25 16:12:34 02550_client_connections_credentials: [ OK ] 12.00 sec.
2025-06-25 16:12:34 00952_part_frozen_info: [ OK ] 0.37 sec.
2025-06-25 16:12:35 00826_cross_to_inner_join: [ OK ] 0.67 sec.
2025-06-25 16:12:35 02887_tuple_element_distributed: [ OK ] 0.27 sec.
2025-06-25 16:12:35 02990_format_select_from_explain: [ OK ] 0.42 sec.
2025-06-25 16:12:35 00191_aggregating_merge_tree_and_final: [ OK ] 0.32 sec.
2025-06-25 16:12:35 02481_default_value_used_in_row_level_filter: [ OK ] 0.27 sec.
2025-06-25 16:12:36 02415_all_new_functions_must_be_documented: [ OK ] 0.22 sec.
2025-06-25 16:12:36 02563_async_insert_bad_data: [ OK ] 6.23 sec.
2025-06-25 16:12:36 02043_user_defined_executable_function_implicit_cast: [ OK ] 0.57 sec.
2025-06-25 16:12:36 02895_peak_memory_usage_http_headers_regression: [ OK ] 0.72 sec.
2025-06-25 16:12:37 03165_order_by_duplicate: [ OK ] 0.27 sec.
2025-06-25 16:12:37 02122_parallel_formatting_Markdown: [ OK ] 1.72 sec.
2025-06-25 16:12:37 00503_cast_const_nullable: [ OK ] 0.27 sec.
2025-06-25 16:12:37 00545_weird_aggregate_functions: [ OK ] 0.22 sec.
2025-06-25 16:12:37 02868_operator_is_not_distinct_from_priority: [ OK ] 0.27 sec.
2025-06-25 16:12:37 01851_hedged_connections_external_tables: [ OK ] 0.27 sec.
2025-06-25 16:12:37 01039_row_policy_dcl: [ OK ] 0.67 sec.
2025-06-25 16:12:38 01417_update_permutation_crash: [ OK ] 0.27 sec.
2025-06-25 16:12:38 02956_rocksdb_with_ttl: [ OK ] 3.28 sec.
2025-06-25 16:12:38 01702_toDateTime_from_string_clamping: [ OK ] 0.27 sec.
2025-06-25 16:12:38 02997_projections_formatting: [ OK ] 0.22 sec.
2025-06-25 16:12:38 02962_indexHint_rpn_construction: [ OK ] 0.22 sec.
2025-06-25 16:12:38 02968_analyzer_join_column_not_found: [ OK ] 0.22 sec.
2025-06-25 16:12:38 00715_fetch_merged_or_mutated_part_zookeeper: [ OK ] 4.98 sec.
2025-06-25 16:12:38 01655_quarter_modificator_for_formatDateTime: [ OK ] 0.22 sec.
2025-06-25 16:12:38 02456_keeper_retries_during_insert: [ OK ] 1.52 sec.
2025-06-25 16:12:38 02811_invalid_embedded_rocksdb_create: [ OK ] 0.27 sec.
2025-06-25 16:12:39 03085_analyzer_alias_column_group_by: [ OK ] 0.22 sec.
2025-06-25 16:12:39 02354_tuple_element_with_default: [ OK ] 0.27 sec.
2025-06-25 16:12:39 01549_low_cardinality_materialized_view: [ OK ] 0.27 sec.
2025-06-25 16:12:39 00875_join_right_nulls_ors: [ OK ] 0.37 sec.
2025-06-25 16:12:39 00738_nested_merge_multidimensional_array: [ OK ] 0.27 sec.
2025-06-25 16:12:39 01018_Distributed__shard_num: [ OK ] 0.67 sec.
2025-06-25 16:12:40 00488_column_name_primary: [ OK ] 0.27 sec.
2025-06-25 16:12:40 00974_primary_key_for_lowCardinality: [ OK ] 2.07 sec.
2025-06-25 16:12:40 02896_optimize_array_exists_to_has_with_date: [ OK ] 0.22 sec.
2025-06-25 16:12:40 01431_utf8_ubsan: [ OK ] 0.27 sec.
2025-06-25 16:12:40 00014_select_from_table_with_nested: [ OK ] 0.32 sec.
2025-06-25 16:12:40 02346_to_hour_monotonicity_fix: [ OK ] 0.32 sec.
2025-06-25 16:12:40 01903_http_fields: [ OK ] 1.07 sec.
2025-06-25 16:12:41 02681_comparsion_tuple_elimination_ast: [ OK ] 0.27 sec.
2025-06-25 16:12:41 02998_primary_key_skip_columns: [ SKIPPED ] 0.00 sec.
2025-06-25 16:12:41 Reason: not running for current build
2025-06-25 16:12:41 00732_quorum_insert_lost_part_and_alive_part_zookeeper_long: [ OK ] 0.52 sec.
2025-06-25 16:12:41 03033_lightweight_deletes_sync: [ OK ] 0.32 sec.
2025-06-25 16:12:41 03058_analyzer_ambiguous_columns: [ OK ] 0.32 sec.
2025-06-25 16:12:41 03023_remove_unused_column_distinct: [ OK ] 0.27 sec.
2025-06-25 16:12:42 00437_nulls_first_last: [ OK ] 0.52 sec.
2025-06-25 16:12:42 02592_avro_records_with_same_names: [ OK ] 0.57 sec.
2025-06-25 16:12:42 03172_dynamic_binary_serialization: [ OK ] 11.70 sec.
2025-06-25 16:12:42 02969_functions_to_subcolumns_if_null: [ OK ] 0.27 sec.
2025-06-25 16:12:42 01544_fromModifiedJulianDay: [ OK ] 0.37 sec.
2025-06-25 16:12:42 02669_alter_modify_to_nullable: [ OK ] 0.52 sec.
2025-06-25 16:12:42 00429_point_in_ellipses: [ OK ] 0.22 sec.
2025-06-25 16:12:43 02933_replicated_database_forbid_create_as_select: [ OK ] 2.63 sec.
2025-06-25 16:12:43 01415_sticking_mutations: [ OK ] 13.96 sec.
2025-06-25 16:12:43 02047_log_family_data_file_sizes: [ OK ] 4.63 sec.
2025-06-25 16:12:43 03214_count_distinct_null_key_memory_leak: [ OK ] 1.52 sec.
2025-06-25 16:12:43 02802_clickhouse_disks_s3_copy: [ OK ] 1.12 sec.
2025-06-25 16:12:44 03006_join_on_inequal_expression_3: [ OK ] 0.67 sec.
2025-06-25 16:12:44 02503_in_lc_const_args_bug: [ OK ] 0.27 sec.
2025-06-25 16:12:44 01700_point_in_polygon_ubsan: [ OK ] 0.22 sec.
2025-06-25 16:12:44 01710_projection_detach_part: [ OK ] 0.27 sec.
2025-06-25 16:12:44 02520_group_array_last: [ OK ] 0.47 sec.
2025-06-25 16:12:44 01300_group_by_other_keys_having: [ OK ] 1.02 sec.
2025-06-25 16:12:44 02885_create_distributed_table_without_as: [ OK ] 0.27 sec.
2025-06-25 16:12:44 01330_array_join_in_higher_order_function: [ OK ] 0.27 sec.
2025-06-25 16:12:44 02267_insert_empty_data: [ OK ] 0.27 sec.
2025-06-25 16:12:45 03207_json_read_subcolumns_1_memory: [ OK ] 1.07 sec.
2025-06-25 16:12:45 02050_clickhouse_local_parsing_exception: [ OK ] 0.57 sec.
2025-06-25 16:12:45 01120_join_constants: [ OK ] 0.27 sec.
2025-06-25 16:12:45 01604_explain_ast_of_nonselect_query: [ OK ] 0.22 sec.
2025-06-25 16:12:45 00062_replicated_merge_tree_alter_zookeeper_long: [ OK ] 0.92 sec.
2025-06-25 16:12:45 03095_msan_uuid_string_to_num: [ OK ] 0.22 sec.
2025-06-25 16:12:45 02421_json_decimals_as_strings: [ OK ] 0.27 sec.
2025-06-25 16:12:45 01259_dictionary_custom_settings_ddl: [ OK ] 0.32 sec.
2025-06-25 16:12:45 00346_if_tuple: [ OK ] 0.27 sec.
2025-06-25 16:12:45 02962_join_using_bug_57894: [ OK ] 0.27 sec.
2025-06-25 16:12:45 01768_extended_range: [ OK ] 0.27 sec.
2025-06-25 16:12:45 01034_JSONCompactEachRow: [ OK ] 0.52 sec.
2025-06-25 16:12:45 02488_zero_copy_detached_parts_drop_table: [ OK ] 3.08 sec.
2025-06-25 16:12:45 03228_dynamic_serializations_uninitialized_value: [ OK ] 0.27 sec.
2025-06-25 16:12:46 02553_type_object_analyzer: [ OK ] 0.27 sec.
2025-06-25 16:12:46 01103_check_cpu_instructions_at_startup: [ SKIPPED ] 0.00 sec.
2025-06-25 16:12:46 Reason: not running for current build
2025-06-25 16:12:46 01176_mysql_client_interactive: [ OK ] 0.92 sec.
2025-06-25 16:12:46 01562_agg_null_for_empty_ahead: [ OK ] 0.37 sec.
2025-06-25 16:12:46 01312_case_insensitive_regexp: [ OK ] 0.27 sec.
2025-06-25 16:12:46 00465_nullable_default: [ OK ] 0.22 sec.
2025-06-25 16:12:46 03152_trailing_comma_in_columns_list_in_insert: [ OK ] 0.27 sec.
2025-06-25 16:12:46 00902_entropy: [ OK ] 0.27 sec.
2025-06-25 16:12:46 00957_delta_diff_bug: [ OK ] 0.22 sec.
2025-06-25 16:12:46 01354_tuple_low_cardinality_array_mapped_bug: [ OK ] 0.27 sec.
2025-06-25 16:12:46 02880_indexHint__partition_id: [ OK ] 0.27 sec.
2025-06-25 16:12:47 02833_tuple_concat: [ OK ] 0.32 sec.
2025-06-25 16:12:47 01082_bit_test_out_of_bound: [ OK ] 0.37 sec.
2025-06-25 16:12:47 00846_join_using_tuple_crash: [ OK ] 0.22 sec.
2025-06-25 16:12:47 02286_tuple_numeric_identifier: [ OK ] 0.27 sec.
2025-06-25 16:12:47 02301_harmful_reexec: [ OK ] 0.67 sec.
2025-06-25 16:12:47 02688_long_aggregate_function_names: [ OK ] 0.22 sec.
2025-06-25 16:12:47 02907_backup_restore_flatten_nested: [ OK ] 2.32 sec.
2025-06-25 16:12:47 02932_query_settings_max_size_drop: [ OK ] 0.32 sec.
2025-06-25 16:12:47 01529_union_distinct_and_setting_union_default_mode: [ OK ] 0.37 sec.
2025-06-25 16:12:48 02677_analyzer_compound_expressions: [ OK ] 0.47 sec.
2025-06-25 16:12:48 01499_log_deadlock: [ OK ] 0.32 sec.
2025-06-25 16:12:48 02189_join_type_conversion: [ OK ] 0.22 sec.
2025-06-25 16:12:48 00129_quantile_timing_weighted: [ OK ] 0.27 sec.
2025-06-25 16:12:49 02242_case_insensitive_column_matching: [ OK ] 3.33 sec.
2025-06-25 16:12:49 03038_nested_dynamic_merges_wide_vertical: [ OK ] 2.07 sec.
2025-06-25 16:12:49 01098_msgpack_format: [ OK ] 11.55 sec.
2025-06-25 16:12:50 00030_alter_table: [ OK ] 0.42 sec.
2025-06-25 16:12:50 02832_transform_fixed_string_no_default: [ OK ] 0.27 sec.
2025-06-25 16:12:50 02228_merge_tree_insert_memory_usage: [ OK ] 1.27 sec.
2025-06-25 16:12:50 00468_array_join_multiple_arrays_and_use_original_column: [ OK ] 0.32 sec.
2025-06-25 16:12:50 02995_preliminary_filters_duplicated_columns: [ OK ] 0.27 sec.
2025-06-25 16:12:50 02124_insert_deduplication_token_replica: [ OK ] 0.47 sec.
2025-06-25 16:12:50 02013_json_function_null_column: [ OK ] 0.42 sec.
2025-06-25 16:12:50 00453_top_k: [ OK ] 0.22 sec.
2025-06-25 16:12:50 03148_asof_join_ddb_subquery: [ OK ] 0.27 sec.
2025-06-25 16:12:50 01943_query_id_check: [ OK ] 0.62 sec.
2025-06-25 16:12:51 02163_operators: [ OK ] 0.22 sec.
2025-06-25 16:12:51 02481_xxh3_hash_function: [ OK ] 0.22 sec.
2025-06-25 16:12:51 02043_query_obfuscator_embedded_dictionaries: [ OK ] 0.47 sec.
2025-06-25 16:12:51 01622_constraints_where_optimization: [ OK ] 0.32 sec.
2025-06-25 16:12:51 03077_analyzer_multi_scalar_subquery_aliases: [ OK ] 0.27 sec.
2025-06-25 16:12:51 01032_cityHash64_for_UUID: [ OK ] 0.32 sec.
2025-06-25 16:12:52 00633_materialized_view_and_too_many_parts_zookeeper: [ OK ] 5.03 sec.
2025-06-25 16:12:52 00800_low_cardinality_merge_join: [ OK ] 0.92 sec.
2025-06-25 16:12:52 01280_unicode_whitespaces_lexer: [ OK ] 0.27 sec.
2025-06-25 16:12:52 01284_escape_sequences_php_mysql_style: [ OK ] 0.27 sec.
2025-06-25 16:12:53 02381_compress_marks_and_primary_key: [ OK ] 1.37 sec.
2025-06-25 16:12:53 00502_string_concat_with_array: [ OK ] 0.22 sec.
2025-06-25 16:12:53 02026_arrayDifference_const: [ OK ] 0.22 sec.
2025-06-25 16:12:53 00590_limit_by_column_removal: [ OK ] 0.22 sec.
2025-06-25 16:12:53 02982_parallel_replicas_unexpected_cluster: [ OK ] 0.32 sec.
2025-06-25 16:12:53 01339_client_unrecognized_option: [ OK ] 0.72 sec.
2025-06-25 16:12:54 02027_ngrams: [ OK ] 0.47 sec.
2025-06-25 16:12:54 01062_pm_all_join_with_block_continuation: [ OK ] 6.88 sec.
2025-06-25 16:12:54 03173_distinct_combinator_alignment: [ OK ] 0.27 sec.
2025-06-25 16:12:55 03107_ill_formed_select_in_materialized_view: [ OK ] 0.27 sec.
2025-06-25 16:12:55 01780_column_sparse_filter: [ OK ] 0.37 sec.
2025-06-25 16:12:56 02269_bool_map_sync_after_error: [ OK ] 2.73 sec.
2025-06-25 16:12:56 01942_snowflakeIDToDateTime: [ OK ] 0.42 sec.
2025-06-25 16:12:56 02473_multistep_prewhere: [ OK ] 10.95 sec.
2025-06-25 16:12:57 01890_state_of_state: [ OK ] 0.47 sec.
2025-06-25 16:12:57 01446_json_strings_each_row: [ OK ] 6.13 sec.
2025-06-25 16:12:57 01012_serialize_array_memory_usage: [ OK ] 0.37 sec.
2025-06-25 16:12:57 01903_correct_block_size_prediction_with_default: [ OK ] 7.44 sec.
2025-06-25 16:12:57 01276_alter_rename_column_materialized_expr: [ OK ] 0.37 sec.
2025-06-25 16:12:58 02014_map_different_keys: [ OK ] 0.32 sec.
2025-06-25 16:12:58 02811_primary_key_in_columns: [ OK ] 0.43 sec.
2025-06-25 16:12:58 01171_mv_select_insert_isolation_long: [ OK ] 107.30 sec.
2025-06-25 16:12:58 02918_implicit_sign_column_constraints_for_collapsing_engine: [ OK ] 3.03 sec.
2025-06-25 16:12:58 02366_kql_native_interval_format: [ OK ] 0.27 sec.
2025-06-25 16:12:58 00909_arrayEnumerateUniq: [ OK ] 1.17 sec.
2025-06-25 16:12:58 02113_untuple_func_alias: [ OK ] 0.22 sec.
2025-06-25 16:12:58 02871_join_on_system_errors: [ OK ] 0.22 sec.
2025-06-25 16:12:59 01273_h3EdgeAngle_range_check: [ OK ] 0.22 sec.
2025-06-25 16:12:59 02316_hierarchical_dictionaries_nullable_parent_key: [ OK ] 0.52 sec.
2025-06-25 16:12:59 02915_input_table_function_in_subquery: [ OK ] 0.82 sec.
2025-06-25 16:12:59 01668_avg_weighted_ubsan: [ OK ] 0.22 sec.
2025-06-25 16:12:59 02967_parallel_replicas_join_algo_and_analyzer_2: [ OK ] 3.18 sec.
2025-06-25 16:12:59 02789_functions_after_sorting_and_columns_with_same_names_bug: [ OK ] 0.27 sec.
2025-06-25 16:13:00 00999_settings_no_extra_quotes: [ OK ] 0.22 sec.
2025-06-25 16:13:00 00100_subquery_table_identifier: [ OK ] 1.37 sec.
2025-06-25 16:13:00 00730_unicode_terminal_format: [ OK ] 0.32 sec.
2025-06-25 16:13:00 01353_neighbor_overflow: [ OK ] 0.32 sec.
2025-06-25 16:13:00 02842_table_function_file_filter_by_virtual_columns: [ OK ] 0.72 sec.
2025-06-25 16:13:01 01817_storage_buffer_parameters: [ OK ] 0.27 sec.
2025-06-25 16:13:01 01504_rocksdb: [ OK ] 1.62 sec.
2025-06-25 16:13:01 03148_setting_max_streams_to_max_threads_ratio_overflow: [ OK ] 0.32 sec.
2025-06-25 16:13:01 02293_ttest_large_samples: [ OK ] 0.77 sec.
2025-06-25 16:13:01 01040_distributed_background_insert_batch_inserts: [ OK ] 0.47 sec.
2025-06-25 16:13:02 02247_read_bools_as_numbers_json: [ OK ] 4.33 sec.
2025-06-25 16:13:02 02498_storage_join_key_positions: [ OK ] 0.87 sec.
2025-06-25 16:13:02 00627_recursive_alias: [ OK ] 0.27 sec.
2025-06-25 16:13:02 02160_special_functions: [ OK ] 0.37 sec.
2025-06-25 16:13:02 02564_read_in_order_final_desc: [ OK ] 0.27 sec.
2025-06-25 16:13:02 02122_parallel_formatting_PrettyNoEscapes: [ OK ] 3.63 sec.
2025-06-25 16:13:02 01825_new_type_json_insert_select: [ OK ] 0.57 sec.
2025-06-25 16:13:02 01710_projection_with_mixed_pipeline: [ OK ] 0.32 sec.
2025-06-25 16:13:03 02381_analyzer_join_final: [ OK ] 0.27 sec.
2025-06-25 16:13:03 01605_drop_settings_profile_while_assigned: [ OK ] 0.22 sec.
2025-06-25 16:13:03 00439_fixed_string_filter: [ OK ] 0.22 sec.
2025-06-25 16:13:03 02011_tuple_vector_functions: [ OK ] 0.82 sec.
2025-06-25 16:13:03 02562_native_tskv_default_for_omitted_fields: [ OK ] 3.38 sec.
2025-06-25 16:13:03 01821_to_date_time_ubsan: [ OK ] 0.27 sec.
2025-06-25 16:13:04 01767_timezoneOf: [ OK ] 0.57 sec.
2025-06-25 16:13:04 01958_partial_hour_timezone: [ OK ] 0.27 sec.
2025-06-25 16:13:04 01414_freeze_does_not_prevent_alters: [ OK ] 0.32 sec.
2025-06-25 16:13:04 03127_argMin_combinator_state: [ OK ] 0.27 sec.
2025-06-25 16:13:04 00725_join_on_bug_3: [ OK ] 0.27 sec.
2025-06-25 16:13:04 01651_lc_insert_tiny_log_3: [ OK ] 1.92 sec.
2025-06-25 16:13:04 01416_clear_column_pk: [ OK ] 0.27 sec.
2025-06-25 16:13:04 03215_parsing_archive_name_s3: [ OK ] 0.42 sec.
2025-06-25 16:13:04 02504_regexp_dictionary_ua_parser: [ OK ] 2.42 sec.
2025-06-25 16:13:04 03215_parquet_index: [ OK ] 0.28 sec.
2025-06-25 16:13:04 02883_array_scalar_mult_div_modulo: [ OK ] 0.37 sec.
2025-06-25 16:13:04 01930_optimize_skip_unused_shards_rewrite_in: [ OK ] 0.82 sec.
2025-06-25 16:13:05 00619_extract: [ OK ] 0.27 sec.
2025-06-25 16:13:05 03063_analyzer_multi_join_wrong_table_specifier: [ OK ] 0.33 sec.
2025-06-25 16:13:05 00678_shard_funnel_window: [ OK ] 0.37 sec.
2025-06-25 16:13:05 01533_distinct_depends_on_max_threads: [ OK ] 0.47 sec.
2025-06-25 16:13:05 01458_is_decimal_overflow: [ OK ] 0.32 sec.
2025-06-25 16:13:05 02498_random_string_in_json_schema_inference: [ OK ] 0.52 sec.
2025-06-25 16:13:05 02811_insert_schema_inference: [ OK ] 0.27 sec.
2025-06-25 16:13:05 02176_optimize_aggregation_in_order_empty: [ OK ] 0.28 sec.
2025-06-25 16:13:06 02733_sparse_columns_reload: [ OK ] 0.27 sec.
2025-06-25 16:13:06 03040_dynamic_type_alters_1_wide_merge_tree: [ OK ] 0.67 sec.
2025-06-25 16:13:06 02986_leftpad_fixedstring: [ OK ] 0.27 sec.
2025-06-25 16:13:06 01115_prewhere_array_join: [ OK ] 0.57 sec.
2025-06-25 16:13:06 02972_parallel_replicas_cte: [ OK ] 0.42 sec.
2025-06-25 16:13:06 02842_suggest_http_page_in_error_message: [ OK ] 0.47 sec.
2025-06-25 16:13:06 02226_low_cardinality_text_bloom_filter_index: [ OK ] 0.57 sec.
2025-06-25 16:13:07 01234_to_string_monotonic: [ OK ] 0.47 sec.
2025-06-25 16:13:07 01113_local_dictionary_type_conversion: [ OK ] 0.27 sec.
2025-06-25 16:13:07 02293_http_header_full_summary_without_progress: [ OK ] 1.42 sec.
2025-06-25 16:13:07 02174_cte_scalar_cache_mv: [ OK ] 1.92 sec.
2025-06-25 16:13:07 00853_join_with_nulls_crash: [ OK ] 0.37 sec.
2025-06-25 16:13:08 01359_codeql: [ OK ] 0.22 sec.
2025-06-25 16:13:08 02973_dictionary_table_exception_fix: [ OK ] 0.27 sec.
2025-06-25 16:13:08 02000_table_function_cluster_macros: [ OK ] 0.27 sec.
2025-06-25 16:13:08 00936_crc_functions: [ OK ] 0.32 sec.
2025-06-25 16:13:08 02835_join_step_explain: [ OK ] 0.32 sec.
2025-06-25 16:13:08 03144_fuzz_quoted_type_name: [ OK ] 0.27 sec.
2025-06-25 16:13:08 02480_suspicious_lowcard_in_key: [ OK ] 0.27 sec.
2025-06-25 16:13:08 02039_group_by_with_totals_having: [ OK ] 0.22 sec.
2025-06-25 16:13:09 03093_filter_push_down_crash: [ OK ] 0.27 sec.
2025-06-25 16:13:09 00514_interval_operators: [ OK ] 0.32 sec.
2025-06-25 16:13:09 03204_format_join_on: [ OK ] 0.62 sec.
2025-06-25 16:13:09 01497_mutation_support_for_storage_memory: [ OK ] 0.27 sec.
2025-06-25 16:13:09 00604_show_create_database: [ OK ] 0.22 sec.
2025-06-25 16:13:09 01674_clickhouse_client_query_param_cte: [ OK ] 0.67 sec.
2025-06-25 16:13:09 00445_join_nullable_keys: [ OK ] 0.27 sec.
2025-06-25 16:13:10 00745_compile_scalar_subquery: [ OK ] 0.32 sec.
2025-06-25 16:13:10 01548_create_table_compound_column_format: [ OK ] 0.42 sec.
2025-06-25 16:13:10 02559_multiple_read_steps_in_prewhere_fuzz: [ OK ] 0.22 sec.
2025-06-25 16:13:10 02487_create_index_normalize_functions: [ OK ] 0.27 sec.
2025-06-25 16:13:10 00204_extract_url_parameter: [ OK ] 0.22 sec.
2025-06-25 16:13:10 02293_grouping_function_group_by: [ OK ] 0.52 sec.
2025-06-25 16:13:11 02680_datetime64_monotonic_check: [ OK ] 0.32 sec.
2025-06-25 16:13:11 01282_system_parts_ttl_info: [ OK ] 0.27 sec.
2025-06-25 16:13:11 02046_low_cardinality_parallel_group_by: [ OK ] 2.88 sec.
2025-06-25 16:13:12 00697_in_subquery_shard: [ OK ] 0.47 sec.
2025-06-25 16:13:12 01049_join_low_card_crash: [ OK ] 0.32 sec.
2025-06-25 16:13:12 00808_not_optimize_predicate: [ OK ] 0.42 sec.
2025-06-25 16:13:12 02792_drop_projection_lwd: [ OK ] 0.32 sec.
2025-06-25 16:13:12 01651_lc_insert_tiny_log_1: [ OK ] 1.87 sec.
2025-06-25 16:13:12 01001_rename_merge_race_condition: [ OK ] 11.40 sec.
2025-06-25 16:13:12 02949_ttl_group_by_bug: [ OK ] 0.37 sec.
2025-06-25 16:13:13 02479_analyzer_aggregation_crash: [ OK ] 0.27 sec.
2025-06-25 16:13:13 01225_drop_dictionary_as_table: [ OK ] 0.27 sec.
2025-06-25 16:13:13 01893_jit_aggregation_function_min_long: [ OK ] 0.87 sec.
2025-06-25 16:13:13 00930_arrayIntersect: [ OK ] 0.37 sec.
2025-06-25 16:13:13 02813_float_parsing: [ OK ] 0.22 sec.
2025-06-25 16:13:14 01514_input_format_json_enum_as_number: [ OK ] 0.27 sec.
2025-06-25 16:13:14 02868_select_support_from_keywords: [ OK ] 0.22 sec.
2025-06-25 16:13:14 03217_primary_index_memory_leak: [ SKIPPED ] 0.00 sec.
2025-06-25 16:13:14 Reason: not running for current build
2025-06-25 16:13:14 02456_alter-nullable-column-bag-2: [ OK ] 0.37 sec.
2025-06-25 16:13:15 00224_shard_distributed_aggregation_memory_efficient_and_overflows: [ OK ] 0.43 sec.
2025-06-25 16:13:15 02918_join_pm_lc_crash: [ OK ] 0.27 sec.
2025-06-25 16:13:15 01059_storage_file_compression: [ OK ] 10.90 sec.
2025-06-25 16:13:16 02355_control_block_size_in_array_join: [ OK ] 0.32 sec.
2025-06-25 16:13:16 01926_order_by_desc_limit: [ OK ] 2.93 sec.
2025-06-25 16:13:16 01345_array_join_LittleMaverick: [ OK ] 0.32 sec.
2025-06-25 16:13:16 01891_partition_by_uuid: [ OK ] 0.27 sec.
2025-06-25 16:13:16 02012_zookeeper_changed_enum_type: [ OK ] 0.37 sec.
2025-06-25 16:13:17 03215_toStartOfWeek_with_dateTime64_fix: [ OK ] 0.22 sec.
2025-06-25 16:13:17 02517_uuid_parsing: [ OK ] 0.27 sec.
2025-06-25 16:13:17 01710_projection_external_aggregate: [ OK ] 0.37 sec.
2025-06-25 16:13:17 01910_view_dictionary_check_refresh: [ OK ] 24.34 sec.
2025-06-25 16:13:17 02944_variant_as_common_type_analyzer: [ OK ] 0.52 sec.
2025-06-25 16:13:18 02798_explain_settings_not_applied_bug: [ OK ] 0.27 sec.
2025-06-25 16:13:18 01137_sample_final: [ OK ] 0.32 sec.
2025-06-25 16:13:18 01640_distributed_async_insert_compression: [ OK ] 0.32 sec.
2025-06-25 16:13:18 03038_ambiguous_column: [ OK ] 0.27 sec.
2025-06-25 16:13:18 00757_enum_defaults_const: [ OK ] 0.22 sec.
2025-06-25 16:13:18 02389_analyzer_nested_lambda: [ OK ] 3.23 sec.
2025-06-25 16:13:19 02007_ipv4_and_ipv6_to_and_from_string: [ OK ] 0.32 sec.
2025-06-25 16:13:19 03198_settings_in_csv_tsv_schema_cache: [ OK ] 0.97 sec.
2025-06-25 16:13:19 01526_param_uuid: [ OK ] 0.72 sec.
2025-06-25 16:13:20 03208_buffer_over_distributed_type_mismatch: [ OK ] 0.62 sec.
2025-06-25 16:13:20 01388_multi_if_optimization: [ OK ] 0.22 sec.
2025-06-25 16:13:20 02813_series_period_detect: [ OK ] 0.37 sec.
2025-06-25 16:13:20 00973_uniq_non_associativity: [ OK ] 0.97 sec.
2025-06-25 16:13:21 01620_fix_simple_state_arg_type: [ OK ] 0.32 sec.
2025-06-25 16:13:21 02124_insert_deduplication_token: [ OK ] 0.42 sec.
2025-06-25 16:13:21 01540_verbatim_partition_pruning: [ OK ] 0.42 sec.
2025-06-25 16:13:21 01079_bit_operations_using_bitset: [ OK ] 0.32 sec.
2025-06-25 16:13:22 01655_plan_optimizations: [ OK ] 9.89 sec.
2025-06-25 16:13:23 02918_multif_for_nullable: [ OK ] 1.42 sec.
2025-06-25 16:13:23 00034_fixed_string_to_number: [ OK ] 0.22 sec.
2025-06-25 16:13:23 02317_distinct_in_order_optimization_explain: [ OK ] 11.15 sec.
2025-06-25 16:13:23 03036_dynamic_read_shared_subcolumns_compact_merge_tree: [ OK ] 17.01 sec.
2025-06-25 16:13:24 02491_part_log_has_table_uuid: [ OK ] 0.52 sec.
2025-06-25 16:13:24 00819_ast_refactoring_bugs: [ OK ] 0.27 sec.
2025-06-25 16:13:24 01685_ssd_cache_dictionary_complex_key: [ OK ] 0.92 sec.
2025-06-25 16:13:24 03271_decimal_monotonic_day_of_week: [ OK ] 0.27 sec.
2025-06-25 16:13:24 02982_unambiguous_alter_commands: [ OK ] 0.27 sec.
2025-06-25 16:13:24 02810_row_binary_with_defaults: [ OK ] 0.27 sec.
2025-06-25 16:13:25 00066_group_by_in: [ OK ] 0.27 sec.
2025-06-25 16:13:25 02567_native_type_conversions: [ OK ] 1.12 sec.
2025-06-25 16:13:25 01825_type_json_2: [ OK ] 0.42 sec.
2025-06-25 16:13:25 02734_sparse_columns_mutation: [ OK ] 0.42 sec.
2025-06-25 16:13:25 02990_format_not_precedence: [ OK ] 0.27 sec.
2025-06-25 16:13:25 02496_remove_redundant_sorting: [ OK ] 8.49 sec.
2025-06-25 16:13:26 00157_aliases_and_lambda_formal_parameters: [ OK ] 0.23 sec.
2025-06-25 16:13:26 02538_analyzer_create_table_as_select: [ OK ] 0.27 sec.
2025-06-25 16:13:26 01621_bar_nan_arguments: [ OK ] 0.27 sec.
2025-06-25 16:13:26 01715_table_function_view_fix: [ OK ] 0.22 sec.
2025-06-25 16:13:26 02122_parallel_formatting_CustomSeparated: [ OK ] 1.77 sec.
2025-06-25 16:13:26 00625_arrays_in_nested: [ OK ] 0.42 sec.
2025-06-25 16:13:26 01927_query_views_log_matview_exceptions: [ OK ] 3.58 sec.
2025-06-25 16:13:26 03015_peder1001: [ OK ] 0.27 sec.
2025-06-25 16:13:26 02479_nullable_primary_key_non_first_column: [ OK ] 0.27 sec.
2025-06-25 16:13:26 01458_named_tuple_millin: [ OK ] 0.22 sec.
2025-06-25 16:13:26 02898_parallel_replicas_custom_key_final: [ OK ] 0.32 sec.
2025-06-25 16:13:26 01518_filtering_aliased_materialized_column: [ OK ] 0.27 sec.
2025-06-25 16:13:26 03165_storage_merge_view_prewhere: [ OK ] 0.37 sec.
2025-06-25 16:13:27 01189_create_as_table_as_table_function: [ OK ] 0.22 sec.
2025-06-25 16:13:27 00679_uuid_in_key: [ OK ] 0.32 sec.
2025-06-25 16:13:27 01508_query_obfuscator: [ OK ] 0.58 sec.
2025-06-25 16:13:27 03161_lightweight_delete_projection: [ OK ] 0.32 sec.
2025-06-25 16:13:27 00988_constraints_replication_zookeeper_long: [ OK ] 0.42 sec.
2025-06-25 16:13:27 03205_system_sync_replica_format: [ OK ] 0.22 sec.
2025-06-25 16:13:27 02243_make_date32_mysql: [ OK ] 0.37 sec.
2025-06-25 16:13:27 00586_removing_unused_columns_from_subquery: [ OK ] 0.32 sec.
2025-06-25 16:13:28 01710_minmax_count_projection_distributed_query: [ OK ] 0.32 sec.
2025-06-25 16:13:28 00296_url_parameters: [ OK ] 0.32 sec.
2025-06-25 16:13:28 01650_fetch_patition_with_macro_in_zk_path_long: [ OK ] 0.37 sec.
2025-06-25 16:13:28 02346_fulltext_index_search: [ OK ] 1.47 sec.
2025-06-25 16:13:28 02346_fulltext_index_bug52019: [ OK ] 0.32 sec.
2025-06-25 16:13:28 00878_join_unexpected_results: [ OK ] 0.48 sec.
2025-06-25 16:13:29 02231_hierarchical_dictionaries_constant: [ OK ] 0.42 sec.
2025-06-25 16:13:29 03031_clickhouse_local_input: [ OK ] 0.93 sec.
2025-06-25 16:13:29 02859_replicated_db_name_zookeeper: [ OK ] 1.72 sec.
2025-06-25 16:13:29 01889_check_row_policy_defined_using_user_function: [ OK ] 3.68 sec.
2025-06-25 16:13:30 02442_auxiliary_zookeeper_endpoint_id: [ OK ] 0.47 sec.
2025-06-25 16:13:30 01307_orc_output_format: [ OK ] 1.92 sec.
2025-06-25 16:13:30 02455_improve_feedback_when_replacing_partition_with_different_primary_key: [ OK ] 0.32 sec.
2025-06-25 16:13:30 03037_dynamic_merges_2_horizontal_wide_merge_tree: [ OK ] 0.52 sec.
2025-06-25 16:13:30 01592_toUnixTimestamp_Date: [ OK ] 0.27 sec.
2025-06-25 16:13:30 00723_remerge_sort: [ OK ] 0.47 sec.
2025-06-25 16:13:30 01010_partial_merge_join_const_and_lc: [ OK ] 0.37 sec.
2025-06-25 16:13:30 00513_fractional_time_zones: [ OK ] 0.22 sec.
2025-06-25 16:13:31 01352_generate_random_overflow: [ OK ] 0.27 sec.
2025-06-25 16:13:31 03039_dynamic_summing_merge_tree: [ OK ] 9.84 sec.
2025-06-25 16:13:31 02004_max_hyperscan_regex_length: [ SKIPPED ] 0.00 sec.
2025-06-25 16:13:31 Reason: not running for current build
2025-06-25 16:13:31 02496_row_binary_large_string_size: [ OK ] 0.77 sec.
2025-06-25 16:13:31 02911_cte_invalid_query_analysis: [ OK ] 0.37 sec.
2025-06-25 16:13:31 02002_sampling_and_unknown_column_bug: [ OK ] 0.27 sec.
2025-06-25 16:13:31 01825_type_json_in_other_types: [ OK ] 2.78 sec.
2025-06-25 16:13:32 00746_hashing_tuples: [ OK ] 0.32 sec.
2025-06-25 16:13:32 01338_long_select_and_alter_zookeeper: [ OK ] 13.50 sec.
2025-06-25 16:13:32 00275_shard_quantiles_weighted: [ OK ] 0.47 sec.
2025-06-25 16:13:32 01412_row_from_totals: [ OK ] 0.32 sec.
2025-06-25 16:13:32 00725_join_on_bug_4: [ OK ] 0.27 sec.
2025-06-25 16:13:32 03261_sort_cursor_crash: [ OK ] 0.37 sec.
2025-06-25 16:13:33 00825_protobuf_format_array_3dim: [ OK ] 1.42 sec.
2025-06-25 16:13:33 02122_parallel_formatting_JSONCompactEachRowWithNames: [ OK ] 1.72 sec.
2025-06-25 16:13:34 02385_analyzer_aliases_compound_expression: [ OK ] 0.32 sec.
2025-06-25 16:13:34 02165_h3_edge_length_km: [ OK ] 0.32 sec.
2025-06-25 16:13:34 01016_macros: [ OK ] 0.27 sec.
2025-06-25 16:13:34 01825_new_type_json_multiple_files: [ OK ] 3.18 sec.
2025-06-25 16:13:34 02535_json_bson_each_row_curl: [ OK ] 1.47 sec.
2025-06-25 16:13:34 02325_dates_schema_inference: [ OK ] 0.47 sec.
2025-06-25 16:13:34 02513_prewhere_combine_step_filters: [ OK ] 0.37 sec.
2025-06-25 16:13:34 01710_normal_projections: [ OK ] 4.78 sec.
2025-06-25 16:13:35 03152_analyzer_columns_list: [ OK ] 0.27 sec.
2025-06-25 16:13:35 00967_insert_into_distributed_different_types: [ OK ] 0.27 sec.
2025-06-25 16:13:35 01658_values_ubsan: [ OK ] 0.22 sec.
2025-06-25 16:13:35 02963_single_value_destructor: [ OK ] 0.32 sec.
2025-06-25 16:13:35 03013_forbid_attach_table_if_active_replica_already_exists: [ OK ] 1.52 sec.
2025-06-25 16:13:36 02233_HTTP_ranged: [ OK ] 1.17 sec.
2025-06-25 16:13:36 03156_analyzer_array_join_distributed: [ OK ] 0.37 sec.
2025-06-25 16:13:36 02815_no_throw_in_simple_queries: [ FAIL ] 1.52 sec.
2025-06-25 16:13:36 Reason: return code: 1
2025-06-25 16:13:36 send: spawn id exp3 not open
2025-06-25 16:13:36 while executing
2025-06-25 16:13:36 "send -- "exit\r""
2025-06-25 16:13:36 , result:
2025-06-25 16:13:36
2025-06-25 16:13:36 Failed
2025-06-25 16:13:36 Failed
2025-06-25 16:13:36 Failed
2025-06-25 16:13:36 Failed
2025-06-25 16:13:36 Failed
2025-06-25 16:13:36 Failed
2025-06-25 16:13:36 Failed
2025-06-25 16:13:36 Failed
2025-06-25 16:13:36
2025-06-25 16:13:36 stdout:
2025-06-25 16:13:36 Failed
2025-06-25 16:13:36 Failed
2025-06-25 16:13:36 Failed
2025-06-25 16:13:36 Failed
2025-06-25 16:13:36 Failed
2025-06-25 16:13:36 Failed
2025-06-25 16:13:36 Failed
2025-06-25 16:13:36 Failed
2025-06-25 16:13:36
2025-06-25 16:13:36
2025-06-25 16:13:36 Settings used in the test: --max_insert_threads 3 --group_by_two_level_threshold 1 --group_by_two_level_threshold_bytes 50000000 --distributed_aggregation_memory_efficient 0 --fsync_metadata 0 --output_format_parallel_formatting 1 --input_format_parallel_parsing 0 --min_chunk_bytes_for_parallel_parsing 5577202 --max_read_buffer_size 737300 --prefer_localhost_replica 1 --max_block_size 15705 --max_joined_block_size_rows 98260 --max_threads 1 --optimize_append_index 0 --optimize_if_chain_to_multiif 0 --optimize_if_transform_strings_to_enum 1 --optimize_read_in_order 1 --optimize_or_like_chain 0 --optimize_substitute_columns 0 --enable_multiple_prewhere_read_steps 1 --read_in_order_two_level_merge_threshold 88 --optimize_aggregation_in_order 0 --aggregation_in_order_max_block_bytes 31491032 --use_uncompressed_cache 1 --min_bytes_to_use_direct_io 1126656212 --min_bytes_to_use_mmap_io 1 --local_filesystem_read_method mmap --remote_filesystem_read_method read --local_filesystem_read_prefetch 0 --filesystem_cache_segments_batch_size 10 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 0 --throw_on_error_from_cache_on_write_operations 1 --remote_filesystem_read_prefetch 0 --allow_prefetched_read_pool_for_remote_filesystem 0 --filesystem_prefetch_max_memory_usage 128Mi --filesystem_prefetches_limit 10 --filesystem_prefetch_min_bytes_for_single_read_task 1Mi --filesystem_prefetch_step_marks 0 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 0 --compile_sort_description 0 --merge_tree_coarse_index_granularity 6 --optimize_distinct_in_order 0 --max_bytes_before_external_sort 0 --max_bytes_before_external_group_by 10737418240 --max_bytes_before_remerge_sort 801881049 --min_compress_block_size 2146161 --max_compress_block_size 2432018 --merge_tree_compact_parts_min_granules_to_multibuffer_read 47 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 7756733 --http_wait_end_of_query False --enable_memory_bound_merging_of_aggregation_results 0 --min_count_to_compile_expression 0 --min_count_to_compile_aggregate_expression 0 --min_count_to_compile_sort_description 3 --session_timezone Africa/Khartoum --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction False --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.44 --prefer_external_sort_block_bytes 0 --cross_join_min_rows_to_compress 0 --cross_join_min_bytes_to_compress 1 --min_external_table_block_size_bytes 1 --max_parsing_threads 10 --optimize_functions_to_subcolumns 0 --parallel_replicas_local_plan 1
2025-06-25 16:13:36
2025-06-25 16:13:36 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 1.0 --prefer_fetch_merged_part_size_threshold 10737418240 --vertical_merge_algorithm_min_rows_to_activate 1000000 --vertical_merge_algorithm_min_columns_to_activate 1 --allow_vertical_merges_from_compact_to_wide_parts 0 --min_merge_bytes_to_use_direct_io 2149131262 --index_granularity_bytes 12722337 --merge_max_block_size 18031 --index_granularity 54556 --min_bytes_for_wide_part 155784434 --marks_compress_block_size 45688 --primary_key_compress_block_size 33378 --replace_long_file_name_to_hash 1 --max_file_name_length 8 --min_bytes_for_full_part_storage 404054081 --compact_parts_max_bytes_to_buffer 44109717 --compact_parts_max_granules_to_buffer 1 --compact_parts_merge_max_bytes_to_prefetch_part 21500785 --cache_populated_by_fetch 0 --concurrent_part_removal_threshold 88 --old_parts_lifetime 477
2025-06-25 16:13:36
2025-06-25 16:13:36 Database: test_ne5y56n5
2025-06-25 16:13:36 00649_quantile_tdigest_negative: [ OK ] 0.27 sec.
2025-06-25 16:13:36 02311_system_zookeeper_insert: [ OK ] 0.47 sec.
2025-06-25 16:13:36 02125_fix_storage_filelog: [ OK ] 0.22 sec.
2025-06-25 16:13:37 00476_pretty_formats_and_widths: [ OK ] 0.42 sec.
2025-06-25 16:13:37 02582_async_reading_with_small_limit: [ OK ] 0.33 sec.
2025-06-25 16:13:37 01710_normal_projection_join_plan_fix: [ OK ] 0.43 sec.
2025-06-25 16:13:38 03013_repeat_with_nonnative_integers: [ OK ] 0.43 sec.
2025-06-25 16:13:38 02844_table_function_url_filter_by_virtual_columns: [ OK ] 0.98 sec.
2025-06-25 16:13:38 00434_tonullable: [ OK ] 0.23 sec.
2025-06-25 16:13:39 03037_dynamic_merges_1_horizontal_compact_wide_tree: [ OK ] 3.28 sec.
2025-06-25 16:13:39 02833_local_with_dialect: [ OK ] 0.82 sec.
2025-06-25 16:13:39 01459_default_value_of_argument_type_nullptr_dereference: [ OK ] 0.29 sec.
2025-06-25 16:13:39 01508_format_regexp_raw: [ OK ] 1.17 sec.
2025-06-25 16:13:40 02764_index_analysis_fix: [ OK ] 0.33 sec.
2025-06-25 16:13:40 01214_point_in_Mecca: [ OK ] 1.04 sec.
2025-06-25 16:13:40 00566_enum_min_max: [ OK ] 0.39 sec.
2025-06-25 16:13:41 01532_tuple_with_name_type: [ OK ] 0.46 sec.
2025-06-25 16:13:41 00943_mv_rename_without_inner_table: [ OK ] 0.27 sec.
2025-06-25 16:13:42 00365_statistics_in_formats: [ OK ] 2.59 sec.
2025-06-25 16:13:42 02354_vector_search_bugs: [ OK ] 0.65 sec.
2025-06-25 16:13:42 01634_summap_nullable: [ OK ] 0.34 sec.
2025-06-25 16:13:42 00411_long_accurate_number_comparison_int1: [ OK ] 12.01 sec.
2025-06-25 16:13:43 01125_generate_random_qoega: [ OK ] 0.42 sec.
2025-06-25 16:13:43 01451_wrong_error_long_query: [ OK ] 0.78 sec.
2025-06-25 16:13:43 03035_dynamic_sorting: [ OK ] 0.48 sec.
2025-06-25 16:13:43 01731_async_task_queue_wait: [ OK ] 3.24 sec.
2025-06-25 16:13:43 00472_create_view_if_not_exists: [ OK ] 0.40 sec.
2025-06-25 16:13:44 00836_indices_alter_replicated_zookeeper_long: [ OK ] 0.68 sec.
2025-06-25 16:13:44 02517_avro_bool_type: [ OK ] 0.99 sec.
2025-06-25 16:13:44 01009_insert_select_data_loss: [ OK ] 0.27 sec.
2025-06-25 16:13:44 01691_DateTime64_clamp: [ OK ] 0.40 sec.
2025-06-25 16:13:44 02994_merge_tree_mutations_cleanup: [ OK ] 10.30 sec.
2025-06-25 16:13:44 00938_test_retention_function: [ OK ] 0.47 sec.
2025-06-25 16:13:45 01508_race_condition_rename_clear_zookeeper_long: [ OK ] 12.96 sec.
2025-06-25 16:13:45 00310_tskv: [ OK ] 1.88 sec.
2025-06-25 16:13:45 02896_leading_zeroes_no_octal: [ OK ] 1.56 sec.
2025-06-25 16:13:45 00696_system_columns_limit: [ OK ] 0.27 sec.
2025-06-25 16:13:45 01380_nullable_state: [ OK ] 0.63 sec.
2025-06-25 16:13:45 00178_query_datetime64_index: [ OK ] 0.35 sec.
2025-06-25 16:13:45 01402_cast_nullable_string_to_enum: [ OK ] 0.34 sec.
2025-06-25 16:13:45 01785_parallel_formatting_memory: [ OK ] 1.48 sec.
2025-06-25 16:13:45 02730_with_fill_by_sorting_prefix: [ OK ] 0.59 sec.
2025-06-25 16:13:46 02241_short_circuit_short_column: [ OK ] 0.30 sec.
2025-06-25 16:13:46 00832_storage_file_lock: [ OK ] 0.29 sec.
2025-06-25 16:13:46 01923_different_expression_name_alias: [ OK ] 0.50 sec.
2025-06-25 16:13:46 02235_add_part_offset_virtual_column: [ OK ] 1.02 sec.
2025-06-25 16:13:46 01202_array_auc_special: [ OK ] 0.37 sec.
2025-06-25 16:13:46 02916_distributed_skip_unavailable_shards: [ OK ] 0.27 sec.
2025-06-25 16:13:46 02554_invalid_create_view_syntax: [ OK ] 0.33 sec.
2025-06-25 16:13:47 02131_row_policies_combination: [ OK ] 0.42 sec.
2025-06-25 16:13:47 02908_filesystem_cache_as_collection: [ OK ] 0.33 sec.
2025-06-25 16:13:48 00612_pk_in_tuple_perf: [ OK ] 3.10 sec.
2025-06-25 16:13:48 01939_network_receive_bytes_metrics: [ OK ] 2.28 sec.
2025-06-25 16:13:48 02998_projection_after_attach_partition: [ OK ] 0.45 sec.
2025-06-25 16:13:48 00258_materializing_tuples: [ OK ] 0.42 sec.
2025-06-25 16:13:48 01825_type_json_16: [ OK ] 2.63 sec.
2025-06-25 16:13:49 02207_ttl_move_if_exists: [ OK ] 0.34 sec.
2025-06-25 16:13:49 02368_analyzer_table_functions: [ OK ] 0.43 sec.
2025-06-25 16:13:49 00931_low_cardinality_read_with_empty_array: [ OK ] 0.53 sec.
2025-06-25 16:13:49 03066_analyzer_global_with_statement: [ OK ] 0.22 sec.
2025-06-25 16:13:49 03013_group_by_use_nulls_with_materialize_and_analyzer: [ OK ] 0.34 sec.
2025-06-25 16:13:49 01045_bloom_filter_null_array: [ OK ] 0.53 sec.
2025-06-25 16:13:50 02499_analyzer_set_index: [ OK ] 0.44 sec.
2025-06-25 16:13:50 01721_join_implicit_cast_long: [ OK ] 3.65 sec.
2025-06-25 16:13:50 01081_demangle: [ OK ] 0.28 sec.
2025-06-25 16:13:50 02686_bson3: [ OK ] 0.28 sec.
2025-06-25 16:13:51 00900_orc_arrays_load: [ OK ] 2.39 sec.
2025-06-25 16:13:51 00484_preferred_max_column_in_block_size_bytes: [ OK ] 0.82 sec.
2025-06-25 16:13:52 01273_arrow_dictionaries_load: [ OK ] 5.24 sec.
2025-06-25 16:13:52 02345_analyzer_subqueries: [ OK ] 0.39 sec.
2025-06-25 16:13:52 02112_skip_index_set_and_or: [ OK ] 0.43 sec.
2025-06-25 16:13:52 01882_total_rows_approx: [ OK ] 2.07 sec.
2025-06-25 16:13:53 02983_empty_map: [ OK ] 0.72 sec.
2025-06-25 16:13:53 02426_orc_bug: [ OK ] 0.78 sec.
2025-06-25 16:13:53 02124_encrypt_decrypt_nullable: [ OK ] 0.34 sec.
2025-06-25 16:13:53 03173_check_cyclic_dependencies_on_create_and_rename: [ OK ] 0.43 sec.
2025-06-25 16:13:53 00975_recursive_materialized_view: [ OK ] 0.27 sec.
2025-06-25 16:13:54 00540_bad_data_types: [ OK ] 4.59 sec.
2025-06-25 16:13:54 02991_count_rewrite_analyzer: [ OK ] 0.42 sec.
2025-06-25 16:13:54 03352_distinct_sorted_bug: [ OK ] 0.22 sec.
2025-06-25 16:13:54 02119_sumcount: [ OK ] 0.63 sec.
2025-06-25 16:13:54 02378_part_log_profile_events: [ OK ] 1.22 sec.
2025-06-25 16:13:54 01710_force_use_projection: [ OK ] 0.32 sec.
2025-06-25 16:13:54 00038_totals_limit: [ OK ] 0.38 sec.
2025-06-25 16:13:55 02916_set_formatting: [ OK ] 0.23 sec.
2025-06-25 16:13:55 02495_concat_with_separator: [ OK ] 0.73 sec.
2025-06-25 16:13:55 01292_quantile_array_bug: [ OK ] 0.38 sec.
2025-06-25 16:13:55 01442_merge_detach_attach_long: [ SKIPPED ] 0.00 sec.
2025-06-25 16:13:55 Reason: not running for current build
2025-06-25 16:13:55 03019_numbers_pretty: [ OK ] 0.42 sec.
2025-06-25 16:13:55 01839_join_to_subqueries_rewriter_columns_matcher: [ OK ] 0.43 sec.
2025-06-25 16:13:55 02815_first_line: [ OK ] 0.38 sec.
2025-06-25 16:13:55 01085_extract_all_empty: [ OK ] 0.38 sec.
2025-06-25 16:13:56 02186_range_hashed_dictionary_intersecting_intervals: [ OK ] 0.39 sec.
2025-06-25 16:13:56 02267_jsonlines_ndjson_format: [ OK ] 0.28 sec.
2025-06-25 16:13:56 02900_buffer_table_alter_race: [ OK ] 8.70 sec.
2025-06-25 16:13:56 02340_analyzer_functions: [ OK ] 0.33 sec.
2025-06-25 16:13:56 01532_clickhouse_local_tmp_folder: [ OK ] 0.79 sec.
2025-06-25 16:13:56 01771_datetime64_no_time_part: [ OK ] 0.33 sec.
2025-06-25 16:13:56 00534_functions_bad_arguments12: [ SKIPPED ] 0.00 sec.
2025-06-25 16:13:56 Reason: not running for current build
2025-06-25 16:13:57 02538_alter_rename_sequence: [ OK ] 0.53 sec.
2025-06-25 16:13:57 01413_truncate_without_table_keyword: [ OK ] 0.38 sec.
2025-06-25 16:13:57 02125_lz4_compression_bug_Values: [ OK ] 5.09 sec.
2025-06-25 16:13:57 01614_with_fill_with_limit: [ OK ] 0.29 sec.
2025-06-25 16:13:57 02931_ubsan_error_arena_aligned_alloc: [ OK ] 0.22 sec.
2025-06-25 16:13:57 00065_shard_float_literals_formatting: [ OK ] 0.30 sec.
2025-06-25 16:13:58 00700_decimal_math: [ OK ] 0.54 sec.
2025-06-25 16:13:58 01064_pm_all_join_const_and_nullable: [ OK ] 0.65 sec.
2025-06-25 16:13:58 02225_hints_for_indeices: [ OK ] 2.04 sec.
2025-06-25 16:13:59 01088_benchmark_query_id: [ OK ] 1.54 sec.
2025-06-25 16:13:59 02012_changed_enum_type_non_replicated: [ OK ] 0.32 sec.
2025-06-25 16:13:59 00940_order_by_read_in_order_query_plan: [ OK ] 1.53 sec.
2025-06-25 16:13:59 01050_engine_join_view_crash: [ OK ] 0.33 sec.
2025-06-25 16:13:59 00554_nested_and_table_engines: [ OK ] 0.70 sec.
2025-06-25 16:13:59 03209_json_type_horizontal_merges: [ SKIPPED ] 0.00 sec.
2025-06-25 16:13:59 Reason: not running for current build
2025-06-25 16:13:59 00971_merge_tree_uniform_read_distribution_and_max_rows_to_read: [ OK ] 0.43 sec.
2025-06-25 16:14:00 03155_explain_current_transaction: [ OK ] 0.29 sec.
2025-06-25 16:14:00 03040_dynamic_type_alters_1_memory: [ OK ] 0.64 sec.
2025-06-25 16:14:00 01074_h3_range_check: [ OK ] 0.32 sec.
2025-06-25 16:14:01 01079_bad_alters_zookeeper_long: [ OK ] 7.17 sec.
2025-06-25 16:14:01 02152_dictionary_date32_type: [ OK ] 0.38 sec.
2025-06-25 16:14:01 03246_skipping_index_70108: [ OK ] 1.29 sec.
2025-06-25 16:14:02 02009_body_query_params: [ OK ] 0.98 sec.
2025-06-25 16:14:03 01657_test_toHour_mysql_compatibility: [ OK ] 0.37 sec.
2025-06-25 16:14:03 01072_json_each_row_data_in_square_brackets: [ OK ] 0.45 sec.
2025-06-25 16:14:04 01308_orc_output_format_arrays: [ OK ] 2.15 sec.
2025-06-25 16:14:04 02251_alter_enum_nested_struct: [ OK ] 0.47 sec.
2025-06-25 16:14:04 03131_deprecated_functions: [ OK ] 0.39 sec.
2025-06-25 16:14:04 03237_get_subcolumn_low_cardinality_column: [ OK ] 0.22 sec.
2025-06-25 16:14:04 01460_mark_inclusion_search_crash: [ OK ] 0.39 sec.
2025-06-25 16:14:05 00581_limit_on_result_and_subquery_and_insert: [ OK ] 0.43 sec.
2025-06-25 16:14:05 02118_deserialize_whole_text: [ OK ] 5.61 sec.
2025-06-25 16:14:05 01710_projections_partial_optimize_aggregation_in_order: [ OK ] 5.94 sec.
2025-06-25 16:14:05 00681_duplicate_columns_inside_union_all_stas_sviridov: [ OK ] 0.27 sec.
2025-06-25 16:14:05 01389_filter_by_virtual_columns: [ OK ] 0.24 sec.
2025-06-25 16:14:05 02184_ipv6_select_parsing: [ OK ] 0.28 sec.
2025-06-25 16:14:06 01527_bad_aggregation_in_lambda: [ OK ] 0.37 sec.
2025-06-25 16:14:06 02881_system_detached_parts_modification_time: [ OK ] 0.27 sec.
2025-06-25 16:14:06 02786_parquet_big_integer_compatibility: [ OK ] 1.18 sec.
2025-06-25 16:14:06 00550_join_insert_select: [ OK ] 1.14 sec.
2025-06-25 16:14:06 02461_cancel_finish_race: [ OK ] 30.54 sec.
2025-06-25 16:14:06 03095_merge_and_buffer_tables: [ OK ] 0.37 sec.
2025-06-25 16:14:07 01131_max_rows_to_sort: [ OK ] 0.27 sec.
2025-06-25 16:14:07 03217_filtering_in_storage_merge: [ OK ] 0.32 sec.
2025-06-25 16:14:07 01024__getScalar: [ OK ] 0.27 sec.
2025-06-25 16:14:07 03164_parallel_replicas_range_filter_min_max: [ OK ] 0.52 sec.
2025-06-25 16:14:07 01716_drop_rename_sign_column: [ OK ] 0.37 sec.
2025-06-25 16:14:07 02366_normalize_aggregate_function_types_and_states: [ OK ] 0.27 sec.
2025-06-25 16:14:07 02845_domain_rfc_support_ipv6: [ OK ] 0.37 sec.
2025-06-25 16:14:08 02242_make_date_mysql: [ OK ] 0.37 sec.
2025-06-25 16:14:08 01034_values_parse_float_bug: [ OK ] 1.89 sec.
2025-06-25 16:14:08 02294_system_certificates: [ OK ] 0.27 sec.
2025-06-25 16:14:08 00732_quorum_insert_lost_part_zookeeper_long: [ OK ] 0.42 sec.
2025-06-25 16:14:08 02769_compare_functions_nan: [ OK ] 0.42 sec.
2025-06-25 16:14:09 01812_optimize_skip_unused_shards_single_node: [ OK ] 0.22 sec.
2025-06-25 16:14:09 02718_parquet_metadata_format: [ OK ] 1.32 sec.
2025-06-25 16:14:09 02398_subquery_where_pushdown_and_limit_offset: [ OK ] 0.27 sec.
2025-06-25 16:14:09 01075_allowed_client_hosts: [ OK ] 0.27 sec.
2025-06-25 16:14:09 02242_optimize_to_subcolumns_no_storage: [ OK ] 0.22 sec.
2025-06-25 16:14:09 01096_zeros: [ OK ] 0.42 sec.
2025-06-25 16:14:09 02563_progress_when_no_rows_from_prewhere: [ SKIPPED ] 0.00 sec.
2025-06-25 16:14:09 Reason: not running for current build
2025-06-25 16:14:09 01762_deltasumtimestamp: [ OK ] 0.27 sec.
2025-06-25 16:14:09 01031_pmj_new_any_semi_join: [ OK ] 0.42 sec.
2025-06-25 16:14:09 01811_storage_buffer_flush_parameters: [ OK ] 2.53 sec.
2025-06-25 16:14:09 00122_join_with_subquery_with_subquery: [ OK ] 0.22 sec.
2025-06-25 16:14:10 01035_prewhere_with_alias: [ OK ] 0.27 sec.
2025-06-25 16:14:10 02344_analyzer_multiple_aliases_for_expression: [ OK ] 0.32 sec.
2025-06-25 16:14:10 03151_external_cross_join: [ OK ] 1.02 sec.
2025-06-25 16:14:11 00109_shard_totals_after_having: [ OK ] 0.87 sec.
2025-06-25 16:14:11 03305_compressed_memory_eng_crash_reading_subcolumn: [ OK ] 0.22 sec.
2025-06-25 16:14:11 00851_http_insert_json_defaults: [ OK ] 1.32 sec.
2025-06-25 16:14:11 01663_test_toDate_mysql_compatibility: [ OK ] 0.22 sec.
2025-06-25 16:14:11 03168_fuzz_multiIf_short_circuit: [ OK ] 0.22 sec.
2025-06-25 16:14:11 02907_fromDaysSinceYearZero: [ OK ] 0.52 sec.
2025-06-25 16:14:11 01654_test_writer_block_sequence: [ OK ] 11.73 sec.
2025-06-25 16:14:11 02136_scalar_read_rows_json: [ OK ] 0.87 sec.
2025-06-25 16:14:11 01699_timezoneOffset: [ OK ] 0.42 sec.
2025-06-25 16:14:11 01247_least_greatest_filimonov: [ OK ] 0.22 sec.
2025-06-25 16:14:12 02477_age_date32: [ OK ] 0.52 sec.
2025-06-25 16:14:12 00061_merge_tree_alter: [ OK ] 0.57 sec.
2025-06-25 16:14:12 00909_kill_not_initialized_query: [ OK ] 7.76 sec.
2025-06-25 16:14:12 02316_cast_to_ip_address_default_column: [ OK ] 0.32 sec.
2025-06-25 16:14:13 02845_parquet_odd_decimals: [ OK ] 1.17 sec.
2025-06-25 16:14:13 01274_generate_random_nested: [ OK ] 0.52 sec.
2025-06-25 16:14:13 01149_zookeeper_mutation_stuck_after_replace_partition: [ OK ] 1.32 sec.
2025-06-25 16:14:13 02402_merge_engine_with_view: [ OK ] 0.32 sec.
2025-06-25 16:14:13 00980_zookeeper_merge_tree_alter_settings: [ OK ] 0.82 sec.
2025-06-25 16:14:13 02354_vector_search_legacy_index_compatibility: [ OK ] 0.32 sec.
2025-06-25 16:14:14 03033_dist_settings.optimize_skip_unused_shards_rewrite_in_composite_sharding_key: [ OK ] 0.32 sec.
2025-06-25 16:14:14 02122_parallel_formatting_JSONCompactEachRow: [ OK ] 1.62 sec.
2025-06-25 16:14:14 01825_type_json_ghdata: [ OK ] 3.98 sec.
2025-06-25 16:14:14 00661_array_has_silviucpp: [ OK ] 0.27 sec.
2025-06-25 16:14:14 00839_bitmask_negative: [ OK ] 0.27 sec.
2025-06-25 16:14:14 02381_arrow_dict_to_lc: [ OK ] 0.62 sec.
2025-06-25 16:14:14 02560_tuple_format: [ OK ] 0.67 sec.
2025-06-25 16:14:15 02454_disable_mergetree_with_lightweight_delete_column: [ OK ] 0.37 sec.
2025-06-25 16:14:15 02122_parallel_formatting_JSON: [ OK ] 2.23 sec.
2025-06-25 16:14:15 00980_crash_nullable_decimal: [ OK ] 0.27 sec.
2025-06-25 16:14:15 03001_bad_error_message_higher_order_functions: [ OK ] 0.67 sec.
2025-06-25 16:14:16 02176_toStartOfWeek_overflow_pruning: [ OK ] 0.32 sec.
2025-06-25 16:14:16 01538_fuzz_aggregate: [ OK ] 0.27 sec.
2025-06-25 16:14:16 01353_topk_enum: [ OK ] 0.22 sec.
2025-06-25 16:14:16 02421_truncate_isolation_no_merges: [ OK ] 20.23 sec.
2025-06-25 16:14:16 00196_float32_formatting: [ OK ] 0.27 sec.
2025-06-25 16:14:16 03020_output_format_client: [ OK ] 1.77 sec.
2025-06-25 16:14:16 01710_projections_order_by_complete: [ OK ] 0.32 sec.
2025-06-25 16:14:16 02784_move_all_conditions_to_prewhere_analyzer_asan: [ OK ] 0.32 sec.
2025-06-25 16:14:16 02302_clash_const_aggegate_join: [ OK ] 0.37 sec.
2025-06-25 16:14:16 01118_is_constant: [ OK ] 0.27 sec.
2025-06-25 16:14:17 01450_set_null_const: [ OK ] 0.27 sec.
2025-06-25 16:14:17 02809_has_token: [ OK ] 0.22 sec.
2025-06-25 16:14:17 02480_tets_show_full: [ OK ] 0.92 sec.
2025-06-25 16:14:17 03071_analyzer_array_join_forbid_non_existing_columns: [ OK ] 0.22 sec.
2025-06-25 16:14:17 02021_create_database_with_comment: [ OK ] 2.63 sec.
2025-06-25 16:14:17 01890_jit_aggregation_function_sum_long: [ OK ] 0.82 sec.
2025-06-25 16:14:17 01522_validate_alter_default: [ OK ] 0.22 sec.
2025-06-25 16:14:17 00818_alias_bug_4110: [ OK ] 0.37 sec.
2025-06-25 16:14:17 00362_great_circle_distance: [ OK ] 0.32 sec.
2025-06-25 16:14:17 01922_sum_null_for_remote: [ OK ] 0.27 sec.
2025-06-25 16:14:17 00568_empty_function_with_fixed_string: [ OK ] 0.27 sec.
2025-06-25 16:14:17 01055_prewhere_bugs: [ OK ] 0.32 sec.
2025-06-25 16:14:18 01511_alter_version_versioned_collapsing_merge_tree: [ OK ] 0.37 sec.
2025-06-25 16:14:18 01013_hex_float: [ OK ] 0.27 sec.
2025-06-25 16:14:18 01287_max_execution_speed: [ OK ] 4.38 sec.
2025-06-25 16:14:18 01084_defaults_on_aliases: [ OK ] 0.32 sec.
2025-06-25 16:14:18 01255_geo_types_livace: [ OK ] 0.27 sec.
2025-06-25 16:14:18 02366_kql_summarize: [ OK ] 0.67 sec.
2025-06-25 16:14:18 02469_interval_msan: [ OK ] 0.37 sec.
2025-06-25 16:14:18 03034_recursive_cte_tree_fuzz_crash_fix: [ OK ] 0.72 sec.
2025-06-25 16:14:18 02416_keeper_map: [ OK ] 0.92 sec.
2025-06-25 16:14:18 00432_aggregate_function_scalars_and_constants: [ OK ] 0.47 sec.
2025-06-25 16:14:19 01250_fixed_string_comparison: [ OK ] 0.32 sec.
2025-06-25 16:14:19 02932_parallel_replicas_fuzzer: [ OK ] 0.32 sec.
2025-06-25 16:14:19 02813_func_today_and_alias: [ OK ] 0.22 sec.
2025-06-25 16:14:19 01690_quantilesTiming_ubsan: [ OK ] 0.27 sec.
2025-06-25 16:14:19 03119_analyzer_window_function_in_CTE_alias: [ OK ] 0.27 sec.
2025-06-25 16:14:19 02552_analyzer_optimize_group_by_function_keys_crash: [ OK ] 0.27 sec.
2025-06-25 16:14:19 02921_bit_hamming_distance_big_int: [ OK ] 0.27 sec.
2025-06-25 16:14:20 01559_misplaced_codec_diagnostics: [ OK ] 0.22 sec.
2025-06-25 16:14:20 01288_shard_max_network_bandwidth: [ OK ] 2.72 sec.
2025-06-25 16:14:20 03154_recursive_cte_distributed: [ OK ] 0.47 sec.
2025-06-25 16:14:20 02910_object-json-crash-add-column: [ OK ] 0.42 sec.
2025-06-25 16:14:20 02481_async_insert_dedup_token: [ OK ] 86.28 sec.
2025-06-25 16:14:20 01273_arrow_decimal: [ OK ] 1.77 sec.
2025-06-25 16:14:20 02524_fuzz_and_fuss: [ OK ] 0.22 sec.
2025-06-25 16:14:20 02382_analyzer_matcher_join_using: [ OK ] 0.57 sec.
2025-06-25 16:14:21 01802_rank_corr_mann_whitney_over_window: [ OK ] 0.37 sec.
2025-06-25 16:14:21 01019_array_fill: [ OK ] 0.32 sec.
2025-06-25 16:14:21 02343_group_by_use_nulls: [ OK ] 0.37 sec.
2025-06-25 16:14:21 00164_not_chain: [ OK ] 0.27 sec.
2025-06-25 16:14:21 01881_join_on_conditions_merge: [ OK ] 0.92 sec.
2025-06-25 16:14:21 01786_group_by_pk_many_streams: [ OK ] 0.47 sec.
2025-06-25 16:14:21 03151_pmj_join_non_procssed_clash: [ OK ] 0.32 sec.
2025-06-25 16:14:21 01576_alias_column_rewrite: [ OK ] 0.57 sec.
2025-06-25 16:14:21 02873_s3_presigned_url_and_url_with_special_characters: [ OK ] 8.49 sec.
2025-06-25 16:14:21 00393_if_with_constant_condition: [ OK ] 0.27 sec.
2025-06-25 16:14:21 02894_ast_depth_check: [ OK ] 0.62 sec.
2025-06-25 16:14:22 02098_date32_comparison: [ OK ] 0.32 sec.
2025-06-25 16:14:22 03168_query_log_privileges_not_empty: [ OK ] 3.43 sec.
2025-06-25 16:14:22 02461_mullable_pk_monotonicity_bug: [ OK ] 0.62 sec.
2025-06-25 16:14:22 02584_compressor_codecs: [ OK ] 0.82 sec.
2025-06-25 16:14:22 03160_dynamic_type_agg: [ OK ] 0.27 sec.
2025-06-25 16:14:22 02181_sql_user_defined_functions_invalid_lambda: [ OK ] 0.27 sec.
2025-06-25 16:14:22 01791_dist_INSERT_block_structure_mismatch: [ OK ] 0.67 sec.
2025-06-25 16:14:22 02346_fulltext_index_bug47393: [ OK ] 0.27 sec.
2025-06-25 16:14:22 02708_dotProduct: [ OK ] 0.52 sec.
2025-06-25 16:14:23 02571_local_desc_abort_on_twitter_json: [ OK ] 0.62 sec.
2025-06-25 16:14:23 02764_parallel_replicas_plain_merge_tree: [ OK ] 0.32 sec.
2025-06-25 16:14:23 03169_modify_column_data_loss: [ OK ] 0.37 sec.
2025-06-25 16:14:23 00725_memory_tracking: [ OK ] 0.57 sec.
2025-06-25 16:14:24 03207_json_read_subcolumns_1_compact_merge_tree: [ OK ] 2.37 sec.
2025-06-25 16:14:24 00680_duplicate_columns_inside_union_all: [ OK ] 0.27 sec.
2025-06-25 16:14:24 00974_adaptive_granularity_secondary_index: [ OK ] 0.82 sec.
2025-06-25 16:14:24 02439_merge_selecting_partitions: [ OK ] 3.83 sec.
2025-06-25 16:14:24 00444_join_use_nulls: [ OK ] 0.27 sec.
2025-06-25 16:14:24 03093_special_column_errors: [ OK ] 0.42 sec.
2025-06-25 16:14:25 01498_alter_column_storage_memory: [ OK ] 0.27 sec.
2025-06-25 16:14:25 01087_index_set_ubsan: [ OK ] 0.27 sec.
2025-06-25 16:14:25 02999_ulid_short_circuit: [ OK ] 0.27 sec.
2025-06-25 16:14:26 00029_test_zookeeper_optimize_exception: [ OK ] 3.33 sec.
2025-06-25 16:14:26 00315_quantile_off_by_one: [ OK ] 0.27 sec.
2025-06-25 16:14:26 03039_dynamic_collapsing_merge_tree: [ OK ] 7.84 sec.
2025-06-25 16:14:26 00337_shard_any_heavy: [ OK ] 0.27 sec.
2025-06-25 16:14:26 02317_distinct_in_order_optimization: [ OK ] 0.92 sec.
2025-06-25 16:14:27 02266_protobuf_format_google_wrappers: [ OK ] 3.28 sec.
2025-06-25 16:14:27 02148_cast_type_parsing: [ OK ] 0.27 sec.
2025-06-25 16:14:27 00936_substring_utf8_non_const: [ OK ] 1.37 sec.
2025-06-25 16:14:27 00742_require_join_strictness: [ OK ] 0.22 sec.
2025-06-25 16:14:27 03161_decimal_binary_math: [ OK ] 0.57 sec.
2025-06-25 16:14:28 02789_reading_from_s3_with_connection_pool: [ OK ] 3.18 sec.
2025-06-25 16:14:28 02369_analyzer_array_join_function: [ OK ] 0.37 sec.
2025-06-25 16:14:28 00497_whitespaces_in_insert: [ OK ] 3.43 sec.
2025-06-25 16:14:28 02861_interpolate_alias_precedence: [ OK ] 0.32 sec.
2025-06-25 16:14:28 00048_a_stored_aggregates_merge: [ OK ] 0.32 sec.
2025-06-25 16:14:28 01853_s2_cells_intersect: [ OK ] 0.27 sec.
2025-06-25 16:14:28 00860_unknown_identifier_bug: [ OK ] 0.27 sec.
2025-06-25 16:14:28 03287_dynamic_and_json_squashing_fix: [ OK ] 0.42 sec.
2025-06-25 16:14:28 02364_window_case: [ OK ] 0.22 sec.
2025-06-25 16:14:28 02811_parallel_replicas_prewhere_count: [ OK ] 0.32 sec.
2025-06-25 16:14:29 02504_parse_datetime_best_effort_calebeaires: [ OK ] 0.27 sec.
2025-06-25 16:14:29 00650_array_enumerate_uniq_with_tuples: [ OK ] 0.32 sec.
2025-06-25 16:14:29 02555_davengers_rename_chain: [ OK ] 2.83 sec.
2025-06-25 16:14:29 02002_system_table_with_tuple: [ OK ] 0.67 sec.
2025-06-25 16:14:29 02183_dictionary_date_types: [ OK ] 0.67 sec.
2025-06-25 16:14:30 03143_cte_scope: [ OK ] 0.32 sec.
2025-06-25 16:14:30 02476_fix_lambda_parsing: [ OK ] 0.57 sec.
2025-06-25 16:14:30 02223_h3_test_const_columns: [ OK ] 0.47 sec.
2025-06-25 16:14:30 02771_jit_functions_comparison_crash: [ OK ] 0.32 sec.
2025-06-25 16:14:30 03016_analyzer_groupby_fuzz_59796: [ OK ] 0.27 sec.
2025-06-25 16:14:31 01961_roaring_memory_tracking: [ OK ] 1.67 sec.
2025-06-25 16:14:31 03129_cte_with_final: [ OK ] 0.27 sec.
2025-06-25 16:14:31 02785_left_anti_join_bug: [ OK ] 0.32 sec.
2025-06-25 16:14:31 01460_allow_dollar_and_number_in_identifier: [ OK ] 0.22 sec.
2025-06-25 16:14:31 01603_decimal_mult_float: [ OK ] 0.32 sec.
2025-06-25 16:14:32 02995_forget_partition: [ OK ] 9.79 sec.
2025-06-25 16:14:32 03164_linestring_geometry: [ OK ] 0.27 sec.
2025-06-25 16:14:32 01355_CSV_input_format_allow_errors: [ OK ] 1.43 sec.
2025-06-25 16:14:32 03131_rewrite_sum_if_nullable: [ OK ] 0.32 sec.
2025-06-25 16:14:32 01505_pipeline_executor_UAF: [ OK ] 5.13 sec.
2025-06-25 16:14:32 00900_orc_arrow_parquet_tuples: [ OK ] 3.83 sec.
2025-06-25 16:14:32 01326_build_id: [ OK ] 0.27 sec.
2025-06-25 16:14:33 02507_to_unix_timestamp_overflow: [ OK ] 0.22 sec.
2025-06-25 16:14:33 00453_cast_enum: [ OK ] 0.27 sec.
2025-06-25 16:14:33 01289_min_execution_speed_not_too_early: [ OK ] 0.82 sec.
2025-06-25 16:14:33 01324_settings_documentation: [ OK ] 0.22 sec.
2025-06-25 16:14:33 01774_bar_with_illegal_value: [ OK ] 0.27 sec.
2025-06-25 16:14:33 02151_client_option_echo: [ OK ] 1.17 sec.
2025-06-25 16:14:34 02383_join_and_filtering_set: [ OK ] 2.88 sec.
2025-06-25 16:14:34 00857_global_joinsavel_table_alias: [ OK ] 0.47 sec.
2025-06-25 16:14:34 01351_geohash_assert: [ OK ] 0.27 sec.
2025-06-25 16:14:34 03172_http_content_encoding: [ OK ] 2.12 sec.
2025-06-25 16:14:34 02095_function_get_os_kernel_version: [ OK ] 0.27 sec.
2025-06-25 16:14:34 02724_function_in_left_table_clause_asof_join: [ OK ] 0.27 sec.
2025-06-25 16:14:34 01710_projections_group_by_no_key: [ OK ] 0.27 sec.
2025-06-25 16:14:34 01851_clear_column_referenced_by_mv: [ OK ] 0.22 sec.
2025-06-25 16:14:34 01595_countMatches: [ OK ] 0.42 sec.
2025-06-25 16:14:34 02006_test_positional_arguments_on_cluster: [ OK ] 0.67 sec.
2025-06-25 16:14:34 01232_untuple: [ OK ] 0.27 sec.
2025-06-25 16:14:35 02572_query_views_log_background_thread: [ OK ] 12.05 sec.
2025-06-25 16:14:35 03013_position_const_start_pos: [ OK ] 0.22 sec.
2025-06-25 16:14:35 01663_aes_msan: [ OK ] 0.23 sec.
2025-06-25 16:14:35 01666_gcd_ubsan: [ OK ] 0.37 sec.
2025-06-25 16:14:35 01710_query_log_with_projection_info: [ OK ] 0.62 sec.
2025-06-25 16:14:35 02481_low_cardinality_with_short_circuit_functins: [ OK ] 0.32 sec.
2025-06-25 16:14:35 00098_f_union_all: [ OK ] 0.28 sec.
2025-06-25 16:14:35 02737_arrayJaccardIndex: [ OK ] 0.37 sec.
2025-06-25 16:14:35 02480_client_option_print_num_processed_rows: [ OK ] 1.52 sec.
2025-06-25 16:14:35 03276_functions_to_subcolumns_lc: [ OK ] 0.22 sec.
2025-06-25 16:14:35 00637_sessions_in_http_interface_and_settings: [ OK ] 0.37 sec.
2025-06-25 16:14:36 02766_bitshift_with_const_arguments: [ OK ] 0.32 sec.
2025-06-25 16:14:36 01136_multiple_sets: [ OK ] 0.27 sec.
2025-06-25 16:14:36 03212_thousand_exceptions: [ OK ] 8.89 sec.
2025-06-25 16:14:36 02969_archive_seek: [ OK ] 0.47 sec.
2025-06-25 16:14:36 01686_rocksdb: [ OK ] 0.37 sec.
2025-06-25 16:14:36 03214_backup_and_clear_old_temporary_directories: [ OK ] 2.98 sec.
2025-06-25 16:14:36 00594_alias_in_distributed: [ OK ] 0.47 sec.
2025-06-25 16:14:36 02864_statistics_ddl: [ OK ] 1.07 sec.
2025-06-25 16:14:36 01384_bloom_filter_bad_arguments: [ OK ] 0.32 sec.
2025-06-25 16:14:36 00981_no_virtual_columns: [ OK ] 0.22 sec.
2025-06-25 16:14:36 02998_to_milliseconds: [ OK ] 0.37 sec.
2025-06-25 16:14:36 02953_slow_create_view: [ OK ] 0.27 sec.
2025-06-25 16:14:36 00154_shard_distributed_with_distinct: [ OK ] 0.22 sec.
2025-06-25 16:14:36 02477_age_datetime64: [ OK ] 0.37 sec.
2025-06-25 16:14:37 02554_format_json_columns_for_empty: [ OK ] 0.27 sec.
2025-06-25 16:14:37 01630_simple_aggregate_function_in_summing_merge_tree: [ OK ] 0.32 sec.
2025-06-25 16:14:37 01300_wkt: [ OK ] 0.32 sec.
2025-06-25 16:14:37 03041_recursive_cte_postgres_7: [ OK ] 0.47 sec.
2025-06-25 16:14:37 03003_prql_panic: [ OK ] 0.67 sec.
2025-06-25 16:14:37 00118_storage_join: [ OK ] 0.27 sec.
2025-06-25 16:14:37 02950_parallel_replicas_used_count: [ OK ] 0.67 sec.
2025-06-25 16:14:37 02482_value_block_parsing: [ OK ] 0.57 sec.
2025-06-25 16:14:37 01020_having_without_group_by: [ OK ] 0.22 sec.
2025-06-25 16:14:37 03261_json_hints_types_check: [ OK ] 0.27 sec.
2025-06-25 16:14:38 01825_type_json_7: [ OK ] 1.48 sec.
2025-06-25 16:14:38 03199_queries_with_new_analyzer: [ OK ] 0.27 sec.
2025-06-25 16:14:38 03166_optimize_row_order_during_insert: [ OK ] 0.32 sec.
2025-06-25 16:14:38 02296_nullable_arguments_in_array_filter: [ OK ] 0.27 sec.
2025-06-25 16:14:38 02343_aggregation_pipeline: [ OK ] 0.37 sec.
2025-06-25 16:14:38 01492_array_join_crash_13829: [ OK ] 0.22 sec.
2025-06-25 16:14:38 01750_parsing_exception: [ OK ] 0.67 sec.
2025-06-25 16:14:38 02115_write_buffers_finalize: [ OK ] 6.28 sec.
2025-06-25 16:14:38 02947_dropped_tables_parts: [ OK ] 0.32 sec.
2025-06-25 16:14:38 01769_extended_range_2: [ OK ] 0.32 sec.
2025-06-25 16:14:38 00048_b_stored_aggregates_merge: [ OK ] 0.32 sec.
2025-06-25 16:14:39 03146_bug47862: [ OK ] 0.27 sec.
2025-06-25 16:14:39 03038_move_partition_to_oneself_deadlock: [ OK ] 0.27 sec.
2025-06-25 16:14:39 00626_replace_partition_from_table: [ OK ] 0.52 sec.
2025-06-25 16:14:39 02815_alias_to_length: [ OK ] 0.27 sec.
2025-06-25 16:14:39 03144_asof_join_ddb_doubles: [ OK ] 0.32 sec.
2025-06-25 16:14:39 01825_type_json_13: [ OK ] 1.77 sec.
2025-06-25 16:14:39 00348_tuples: [ OK ] 0.42 sec.
2025-06-25 16:14:39 00947_ml_test: [ OK ] 0.37 sec.
2025-06-25 16:14:40 01058_window_view_event_hop_to_strict_asc: [ OK ] 1.72 sec.
2025-06-25 16:14:40 00534_functions_bad_arguments11: [ SKIPPED ] 0.00 sec.
2025-06-25 16:14:40 Reason: not running for current build
2025-06-25 16:14:40 00601_kill_running_query: [ OK ] 0.52 sec.
2025-06-25 16:14:40 02526_kv_engine_different_filter_type: [ OK ] 0.42 sec.
2025-06-25 16:14:40 00357_to_string_complex_types: [ OK ] 0.27 sec.
2025-06-25 16:14:40 00757_enum_defaults_const_analyzer: [ OK ] 0.27 sec.
2025-06-25 16:14:40 02097_polygon_dictionary_store_key: [ OK ] 0.32 sec.
2025-06-25 16:14:40 02228_unquoted_dates_in_csv_schema_inference: [ OK ] 0.62 sec.
2025-06-25 16:14:40 01825_type_json_missed_values: [ OK ] 0.37 sec.
2025-06-25 16:14:40 00180_attach_materialized_view: [ OK ] 0.22 sec.
2025-06-25 16:14:41 01398_in_tuple_func: [ OK ] 0.27 sec.
2025-06-25 16:14:41 00712_prewhere_with_alias: [ OK ] 0.42 sec.
2025-06-25 16:14:41 03166_mv_prewhere_duplicating_name_bug: [ OK ] 0.27 sec.
2025-06-25 16:14:41 00155_long_merges: [ SKIPPED ] 0.00 sec.
2025-06-25 16:14:41 Reason: not running for current build
2025-06-25 16:14:41 02705_grouping_keys_equal_keys: [ OK ] 0.27 sec.
2025-06-25 16:14:41 00574_empty_strings_deserialization: [ OK ] 1.77 sec.
2025-06-25 16:14:41 01353_nullable_tuple: [ OK ] 0.77 sec.
2025-06-25 16:14:41 02158_ztest: [ OK ] 0.27 sec.
2025-06-25 16:14:41 01220_scalar_optimization_in_alter: [ OK ] 0.27 sec.
2025-06-25 16:14:41 00726_materialized_view_concurrent: [ OK ] 0.32 sec.
2025-06-25 16:14:42 01013_hex_decimal: [ OK ] 0.27 sec.
2025-06-25 16:14:42 00981_in_subquery_with_tuple: [ OK ] 2.53 sec.
2025-06-25 16:14:42 00277_array_filter: [ OK ] 0.27 sec.
2025-06-25 16:14:42 02246_clickhouse_local_drop_database: [ OK ] 1.02 sec.
2025-06-25 16:14:42 02243_make_date32: [ OK ] 0.47 sec.
2025-06-25 16:14:42 02157_readonly_system_suspend: [ OK ] 0.63 sec.
2025-06-25 16:14:42 03036_dynamic_read_subcolumns_memory: [ OK ] 1.02 sec.
2025-06-25 16:14:43 02276_full_sort_join_unsupported: [ OK ] 0.37 sec.
2025-06-25 16:14:43 03162_dynamic_type_nested: [ OK ] 0.27 sec.
2025-06-25 16:14:43 02536_date_from_number_inference_fix: [ OK ] 0.27 sec.
2025-06-25 16:14:43 03042_not_found_column_c1: [ OK ] 0.22 sec.
2025-06-25 16:14:43 02974_backup_query_format_null: [ OK ] 1.32 sec.
2025-06-25 16:14:43 01333_select_abc_asterisk: [ OK ] 0.28 sec.
2025-06-25 16:14:43 00459_group_array_insert_at: [ OK ] 0.27 sec.
2025-06-25 16:14:43 01581_deduplicate_by_columns_local: [ OK ] 0.67 sec.
2025-06-25 16:14:43 00910_decimal_group_array_crash_3783: [ OK ] 0.32 sec.
2025-06-25 16:14:43 02174_cte_scalar_cache: [ OK ] 0.72 sec.
2025-06-25 16:14:44 00490_special_line_separators_and_characters_outside_of_bmp: [ OK ] 0.22 sec.
2025-06-25 16:14:44 00800_low_cardinality_empty_array: [ OK ] 0.27 sec.
2025-06-25 16:14:44 02220_array_join_format: [ OK ] 0.22 sec.
2025-06-25 16:14:44 01025_array_compact_generic: [ OK ] 0.27 sec.
2025-06-25 16:14:44 01710_projection_drop_if_exists: [ OK ] 0.32 sec.
2025-06-25 16:14:44 02678_explain_pipeline_graph_with_projection: [ OK ] 0.27 sec.
2025-06-25 16:14:44 00355_array_of_non_const_convertible_types: [ OK ] 0.39 sec.
2025-06-25 16:14:44 00064_negate_bug: [ OK ] 0.43 sec.
2025-06-25 16:14:45 01519_topK_distributed_parametrized: [ OK ] 0.39 sec.
2025-06-25 16:14:45 01710_projections_and_duplicate_columms: [ OK ] 0.47 sec.
2025-06-25 16:14:45 00098_6_union_all: [ OK ] 0.34 sec.
2025-06-25 16:14:45 02474_timeDiff_UTCTimestamp: [ OK ] 0.42 sec.
2025-06-25 16:14:46 03303_alias_inverse_order: [ OK ] 0.42 sec.
2025-06-25 16:14:46 01581_deduplicate_by_columns_replicated_long: [ OK ] 0.67 sec.
2025-06-25 16:14:47 02950_reading_array_tuple_subcolumns: [ OK ] 0.64 sec.
2025-06-25 16:14:47 03203_optimize_disjunctions_chain_to_in: [ OK ] 0.43 sec.
2025-06-25 16:14:47 01071_in_array: [ OK ] 0.28 sec.
2025-06-25 16:14:48 01326_hostname_alias: [ OK ] 0.43 sec.
2025-06-25 16:14:48 01576_if_null_external_aggregation: [ OK ] 1.79 sec.
2025-06-25 16:14:48 03001_backup_matview_after_modify_query: [ OK ] 3.90 sec.
2025-06-25 16:14:48 02810_async_insert_dedup_replicated_collapsing: [ OK ] 11.80 sec.
2025-06-25 16:14:49 02956_fix_to_start_of_milli_microsecond: [ OK ] 0.54 sec.
2025-06-25 16:14:49 01602_modified_julian_day_msan: [ OK ] 0.37 sec.
2025-06-25 16:14:49 00700_decimal_in_keys: [ OK ] 0.53 sec.
2025-06-25 16:14:49 02429_combinators_in_array_reduce: [ OK ] 0.39 sec.
2025-06-25 16:14:49 02916_replication_protocol_wait_for_part: [ OK ] 10.53 sec.
2025-06-25 16:14:49 02185_arraySlice_negative_offset_size: [ OK ] 0.43 sec.
2025-06-25 16:14:49 02370_lost_part_intersecting_merges: [ OK ] 14.08 sec.
2025-06-25 16:14:50 03212_max_bytes_to_read_for_schema_inference_in_cache: [ OK ] 0.70 sec.
2025-06-25 16:14:50 03164_adapting_parquet_reader_output_size: [ OK ] 1.58 sec.
2025-06-25 16:14:50 00293_shard_max_subquery_depth: [ OK ] 0.63 sec.
2025-06-25 16:14:50 01891_partition_hash_no_long_int: [ OK ] 0.44 sec.
2025-06-25 16:14:50 03209_parameterized_view_with_non_literal_params: [ OK ] 1.07 sec.
2025-06-25 16:14:50 00715_bounding_ratio_merge_empty: [ OK ] 0.44 sec.
2025-06-25 16:14:50 02479_mysql_connect_to_self: [ OK ] 0.83 sec.
2025-06-25 16:14:51 01017_tuplehamming_distance: [ OK ] 0.48 sec.
2025-06-25 16:14:51 02481_i43247_ubsan_in_minmaxany: [ OK ] 1.54 sec.
2025-06-25 16:14:51 02456_bloom_filter_assert: [ OK ] 0.84 sec.
2025-06-25 16:14:51 02012_compress_lz4: [ OK ] 1.76 sec.
2025-06-25 16:14:52 02177_merge_optimize_aggregation_in_order: [ OK ] 0.48 sec.
2025-06-25 16:14:52 01746_long_zlib_http_compression_json_format: [ OK ] 1.35 sec.
2025-06-25 16:14:52 03155_test_move_to_prewhere: [ OK ] 2.06 sec.
2025-06-25 16:14:52 03002_int_div_decimal_with_date_bug: [ OK ] 0.33 sec.
2025-06-25 16:14:53 01948_group_bitmap_and_or_xor_fix: [ OK ] 0.49 sec.
2025-06-25 16:14:53 03010_read_system_parts_table_test: [ OK ] 0.37 sec.
2025-06-25 16:14:53 00929_multi_match_edit_distance: [ OK ] 2.15 sec.
2025-06-25 16:14:53 02718_cli_dashed_options_parsing: [ OK ] 2.94 sec.
2025-06-25 16:14:53 01477_lc_in_merge_join_left_key: [ OK ] 0.99 sec.
2025-06-25 16:14:53 02884_duplicate_index_name: [ OK ] 0.33 sec.
2025-06-25 16:14:54 02158_ztest_cmp: [ OK ] 2.24 sec.
2025-06-25 16:14:54 03144_invalid_filter: [ OK ] 0.28 sec.
2025-06-25 16:14:54 02933_compare_with_bool_as_string: [ OK ] 0.52 sec.
2025-06-25 16:14:54 02843_date_predicate_optimizations_bugs: [ OK ] 0.54 sec.
2025-06-25 16:14:54 00647_select_numbers_with_offset: [ OK ] 0.43 sec.
2025-06-25 16:14:54 00271_agg_state_and_totals: [ OK ] 0.28 sec.
2025-06-25 16:14:54 00570_empty_array_is_const: [ OK ] 0.34 sec.
2025-06-25 16:14:55 01512_create_replicate_merge_tree_one_arg: [ OK ] 0.38 sec.
2025-06-25 16:14:55 01125_dict_ddl_cannot_add_column: [ OK ] 0.43 sec.
2025-06-25 16:14:55 02436_system_zookeeper_context: [ OK ] 0.49 sec.
2025-06-25 16:14:56 02017_bit_shift_left_for_string_integer: [ OK ] 0.99 sec.
2025-06-25 16:14:57 02124_insert_deduplication_token_materialized_views: [ OK ] 1.65 sec.
2025-06-25 16:14:57 03143_join_filter_push_down_filled_join_fix: [ OK ] 0.58 sec.
2025-06-25 16:14:57 01700_mod_negative_type_promotion: [ OK ] 0.39 sec.
2025-06-25 16:14:57 01652_ttl_old_syntax: [ OK ] 0.33 sec.
2025-06-25 16:14:57 03209_json_type_vertical_merges: [ SKIPPED ] 0.00 sec.
2025-06-25 16:14:57 Reason: not running for current build
2025-06-25 16:14:58 03207_json_read_subcolumns_1_wide_merge_tree: [ OK ] 3.81 sec.
2025-06-25 16:14:58 01626_cnf_test: [ OK ] 0.27 sec.
2025-06-25 16:14:58 02132_client_history_navigation: [ OK ] 0.99 sec.
2025-06-25 16:14:58 00725_join_on_bug_2: [ OK ] 0.49 sec.
2025-06-25 16:14:58 02295_GROUP_BY_AggregateFunction: [ OK ] 0.43 sec.
2025-06-25 16:14:59 01940_point_in_polygon_ubsan: [ OK ] 0.39 sec.
2025-06-25 16:14:59 03036_dynamic_read_shared_subcolumns_memory: [ OK ] 5.82 sec.
2025-06-25 16:14:59 01017_in_unconvertible_complex_type: [ OK ] 0.38 sec.
2025-06-25 16:14:59 00980_merge_alter_settings: [ OK ] 0.85 sec.
2025-06-25 16:15:00 00942_mv_rename_table: [ OK ] 0.37 sec.
2025-06-25 16:15:00 03033_final_undefined_last_mark: [ OK ] 0.18 sec.
2025-06-25 16:15:00 02286_convert_decimal_type: [ OK ] 0.32 sec.
2025-06-25 16:15:01 00754_alter_modify_column_partitions: [ OK ] 2.30 sec.
2025-06-25 16:15:01 02841_group_array_sorted: [ OK ] 0.96 sec.
2025-06-25 16:15:01 00837_minmax_index: [ OK ] 2.79 sec.
2025-06-25 16:15:01 01457_order_by_nulls_first: [ OK ] 0.45 sec.
2025-06-25 16:15:01 02540_analyzer_matcher_alias_materialized_columns: [ OK ] 0.48 sec.
2025-06-25 16:15:02 02475_precise_decimal_arithmetics: [ OK ] 0.53 sec.
2025-06-25 16:15:03 03165_parseReadableSize: [ OK ] 0.85 sec.
2025-06-25 16:15:03 02968_url_args: [ OK ] 0.27 sec.
2025-06-25 16:15:04 01231_operator_null_in: [ OK ] 2.51 sec.
2025-06-25 16:15:04 01413_alter_update_supertype: [ OK ] 0.48 sec.
2025-06-25 16:15:04 02560_quantile_min_max: [ OK ] 0.27 sec.
2025-06-25 16:15:04 02751_text_formats_bad_nullable_parsing: [ OK ] 3.05 sec.
2025-06-25 16:15:04 01104_distributed_numbers_test: [ OK ] 0.28 sec.
2025-06-25 16:15:05 03167_empty_tuple_concat: [ OK ] 0.28 sec.
2025-06-25 16:15:05 01560_DateTime_and_DateTime64_comparision: [ OK ] 0.44 sec.
2025-06-25 16:15:05 02869_unicode_minus: [ OK ] 0.27 sec.
2025-06-25 16:15:05 01715_background_checker_blather_zookeeper_long: [ OK ] 10.94 sec.
2025-06-25 16:15:05 01020_function_char: [ OK ] 0.39 sec.
2025-06-25 16:15:05 02424_pod_array_overflow: [ OK ] 0.38 sec.
2025-06-25 16:15:06 02343_analyzer_column_transformers_strict: [ OK ] 0.47 sec.
2025-06-25 16:15:06 02869_http_headers_elapsed_ns: [ OK ] 0.93 sec.
2025-06-25 16:15:06 02177_issue_31009: [ SKIPPED ] 0.00 sec.
2025-06-25 16:15:06 Reason: not running for current build
2025-06-25 16:15:06 00700_decimal_formats: [ OK ] 0.44 sec.
2025-06-25 16:15:06 00909_ngram_distance: [ OK ] 1.27 sec.
2025-06-25 16:15:07 00077_set_keys_fit_128_bits_many_blocks: [ OK ] 0.39 sec.
2025-06-25 16:15:07 00127_group_by_concat: [ OK ] 0.29 sec.
2025-06-25 16:15:07 02862_sorted_distinct_sparse_fix: [ OK ] 0.58 sec.
2025-06-25 16:15:07 01155_old_mutation_parts_to_do: [ OK ] 14.61 sec.
2025-06-25 16:15:08 02907_read_buffer_content_is_cached_multiple_blobs: [ OK ] 0.53 sec.
2025-06-25 16:15:08 00477_parsing_data_types: [ OK ] 0.34 sec.
2025-06-25 16:15:08 02335_column_ttl_expired_column_optimization: [ OK ] 1.27 sec.
2025-06-25 16:15:08 02104_clickhouse_local_columns_description: [ OK ] 0.93 sec.
2025-06-25 16:15:09 02481_pk_analysis_with_enum_to_string: [ OK ] 0.47 sec.
2025-06-25 16:15:09 00114_float_type_result_of_division: [ OK ] 0.28 sec.
2025-06-25 16:15:09 02122_parallel_formatting_JSONCompactStrings: [ OK ] 2.59 sec.
2025-06-25 16:15:11 02661_read_from_archive_tar: [ OK ] 11.07 sec.
2025-06-25 16:15:13 02681_undrop_query_uuid: [ OK ] 4.30 sec.
2025-06-25 16:15:13 02271_replace_partition_many_tables: [ OK ] 30.50 sec.
2025-06-25 16:15:13 02684_bson: [ OK ] 0.27 sec.
2025-06-25 16:15:13 00073_merge_sorting_empty_array_joined: [ OK ] 0.33 sec.
2025-06-25 16:15:14 03121_analyzer_filed_redefenition_in_subquery: [ OK ] 0.45 sec.
2025-06-25 16:15:14 02875_fix_column_decimal_serialization: [ OK ] 0.43 sec.
2025-06-25 16:15:15 02420_stracktrace_debug_symbols: [ OK ] 0.57 sec.
2025-06-25 16:15:15 02561_temporary_table_grants: [ OK ] 5.46 sec.
2025-06-25 16:15:16 00991_system_parts_race_condition_long: [ OK ] 32.90 sec.
2025-06-25 16:15:16 00720_with_cube: [ OK ] 1.48 sec.
2025-06-25 16:15:16 01576_alter_low_cardinality_and_select: [ OK ] 5.31 sec.
2025-06-25 16:15:16 02125_lz4_compression_bug_CSV: [ OK ] 7.06 sec.
2025-06-25 16:15:16 02122_parallel_formatting_JSONStrings: [ OK ] 3.04 sec.
2025-06-25 16:15:16 02414_all_new_table_functions_must_be_documented: [ OK ] 0.22 sec.
2025-06-25 16:15:16 01012_select_limit_x_0: [ OK ] 0.28 sec.
2025-06-25 16:15:16 01051_same_name_alias_with_joins: [ OK ] 0.32 sec.
2025-06-25 16:15:16 00639_startsWith: [ OK ] 0.32 sec.
2025-06-25 16:15:17 02798_generic_transform: [ OK ] 0.32 sec.
2025-06-25 16:15:17 01035_avg: [ OK ] 1.87 sec.
2025-06-25 16:15:17 02661_read_from_archive_zip: [ OK ] 12.66 sec.
2025-06-25 16:15:17 01773_min_max_time_system_parts_datetime64: [ OK ] 0.27 sec.
2025-06-25 16:15:17 01582_distinct_subquery_groupby: [ OK ] 0.32 sec.
2025-06-25 16:15:17 02346_read_in_order_fixed_prefix: [ OK ] 8.80 sec.
2025-06-25 16:15:17 01480_binary_operator_monotonicity: [ OK ] 0.57 sec.
2025-06-25 16:15:17 01906_bigint_accurate_cast_ubsan: [ OK ] 0.37 sec.
2025-06-25 16:15:17 01300_svg: [ OK ] 0.42 sec.
2025-06-25 16:15:17 02792_alter_table_modify_comment: [ OK ] 0.62 sec.
2025-06-25 16:15:17 02472_segfault_expression_parser: [ OK ] 0.22 sec.
2025-06-25 16:15:17 01866_view_persist_settings: [ OK ] 0.52 sec.
2025-06-25 16:15:17 03246_json_simd_rapid_parsers: [ OK ] 0.92 sec.
2025-06-25 16:15:17 01651_map_functions: [ OK ] 0.72 sec.
2025-06-25 16:15:17 01822_union_and_constans_error: [ OK ] 0.32 sec.
2025-06-25 16:15:17 03258_old_analyzer_const_expr_bug: [ OK ] 0.32 sec.
2025-06-25 16:15:18 01664_array_slice_ubsan: [ OK ] 0.22 sec.
2025-06-25 16:15:18 03013_ignore_drop_queries_probability: [ OK ] 0.33 sec.
2025-06-25 16:15:18 01518_cast_nullable_virtual_system_column: [ OK ] 0.27 sec.
2025-06-25 16:15:18 00559_filter_array_generic: [ OK ] 0.22 sec.
2025-06-25 16:15:18 01556_explain_select_with_union_query: [ OK ] 0.32 sec.
2025-06-25 16:15:18 01410_nullable_key_and_index_negate_cond: [ OK ] 0.32 sec.
2025-06-25 16:15:18 02568_json_array_length: [ OK ] 0.32 sec.
2025-06-25 16:15:18 01421_array_nullable_element_nullable_index: [ OK ] 0.27 sec.
2025-06-25 16:15:18 02674_date_int_string_json_inference: [ OK ] 0.22 sec.
2025-06-25 16:15:18 02374_analyzer_array_join: [ OK ] 0.47 sec.
2025-06-25 16:15:18 01651_group_uniq_array_enum: [ OK ] 0.32 sec.
2025-06-25 16:15:18 02915_fpc_overflow: [ OK ] 0.67 sec.
2025-06-25 16:15:18 01147_partial_merge_full_join: [ OK ] 0.92 sec.
2025-06-25 16:15:19 01419_merge_tree_settings_sanity_check: [ OK ] 0.37 sec.
2025-06-25 16:15:19 01011_group_uniq_array_memsan: [ OK ] 0.22 sec.
2025-06-25 16:15:19 01470_test_insert_select_asterisk: [ OK ] 0.32 sec.
2025-06-25 16:15:19 01894_jit_aggregation_function_max_long: [ OK ] 0.82 sec.
2025-06-25 16:15:19 02831_trash: [ OK ] 0.27 sec.
2025-06-25 16:15:19 00053_all_inner_join: [ OK ] 0.27 sec.
2025-06-25 16:15:19 02875_final_invalid_read_ranges_bug: [ OK ] 0.32 sec.
2025-06-25 16:15:19 01036_union_different_columns: [ OK ] 0.22 sec.
2025-06-25 16:15:19 02237_lzma_bug: [ OK ] 2.22 sec.
2025-06-25 16:15:19 02022_storage_filelog_one_file: [ OK ] 2.37 sec.
2025-06-25 16:15:19 02882_primary_key_index_in_function_different_types: [ OK ] 0.32 sec.
2025-06-25 16:15:19 01272_totals_and_filter_bug: [ OK ] 0.27 sec.
2025-06-25 16:15:19 01849_geoToS2: [ OK ] 0.42 sec.
2025-06-25 16:15:20 02325_compatibility_setting_2: [ OK ] 0.32 sec.
2025-06-25 16:15:20 00358_from_string_complex_types: [ OK ] 0.27 sec.
2025-06-25 16:15:20 02813_seriesDecomposeSTL: [ OK ] 0.37 sec.
2025-06-25 16:15:20 02974_analyzer_array_join_subcolumn: [ OK ] 0.37 sec.
2025-06-25 16:15:20 02525_different_engines_in_temporary_tables: [ OK ] 0.37 sec.
2025-06-25 16:15:20 01710_normal_projection_format: [ OK ] 0.22 sec.
2025-06-25 16:15:20 02497_source_part_is_intact_when_mutation: [ OK ] 0.32 sec.
2025-06-25 16:15:20 00589_removal_unused_columns_aggregation: [ OK ] 0.42 sec.
2025-06-25 16:15:20 01702_rewrite_avg_for_algebraic_optimization: [ OK ] 0.32 sec.
2025-06-25 16:15:20 00004_shard_format_ast_and_remote_table: [ OK ] 0.27 sec.
2025-06-25 16:15:20 00268_aliases_without_as_keyword: [ OK ] 0.22 sec.
2025-06-25 16:15:20 01825_new_type_json_12: [ OK ] 2.43 sec.
2025-06-25 16:15:20 01813_quantileBfloat16_nans: [ OK ] 0.27 sec.
2025-06-25 16:15:20 01881_create_as_tuple: [ OK ] 0.27 sec.
2025-06-25 16:15:20 02316_values_table_func_bug: [ OK ] 0.22 sec.
2025-06-25 16:15:20 00416_pocopatch_progress_in_http_headers: [ OK ] 0.62 sec.
2025-06-25 16:15:21 02575_merge_prewhere_default_expression: [ OK ] 0.27 sec.
2025-06-25 16:15:21 03199_fix_auc_tie_handling: [ OK ] 0.27 sec.
2025-06-25 16:15:21 01770_extended_range_3: [ OK ] 0.27 sec.
2025-06-25 16:15:21 00177_inserts_through_http_parts: [ OK ] 0.57 sec.
2025-06-25 16:15:21 03152_join_filter_push_down_equivalent_columns: [ OK ] 0.32 sec.
2025-06-25 16:15:21 03208_numbers_total_rows_approx: [ OK ] 0.27 sec.
2025-06-25 16:15:21 01034_with_fill_and_push_down_predicate: [ OK ] 0.27 sec.
2025-06-25 16:15:21 00712_nan_comparison: [ OK ] 0.32 sec.
2025-06-25 16:15:21 02841_tuple_modulo: [ OK ] 0.27 sec.
2025-06-25 16:15:21 02354_read_in_order_prewhere: [ OK ] 0.62 sec.
2025-06-25 16:15:21 02845_table_function_hdfs_filter_by_virtual_columns: [ OK ] 2.02 sec.
2025-06-25 16:15:21 02353_isnullable: [ OK ] 0.32 sec.
2025-06-25 16:15:21 02962_analyzer_constant_set: [ OK ] 0.32 sec.
2025-06-25 16:15:21 03207_json_read_subcolumns_2_memory: [ SKIPPED ] 0.00 sec.
2025-06-25 16:15:21 Reason: not running for current build
2025-06-25 16:15:22 02234_position_case_insensitive_utf8: [ OK ] 0.22 sec.
2025-06-25 16:15:22 02699_polygons_sym_difference_total: [ OK ] 0.27 sec.
2025-06-25 16:15:22 02503_join_switch_alias_fuzz: [ OK ] 0.22 sec.
2025-06-25 16:15:22 03203_multiif_and_where_2_conditions_old_analyzer_bug: [ OK ] 0.27 sec.
2025-06-25 16:15:22 01838_system_dictionaries_virtual_key_column: [ OK ] 0.27 sec.
2025-06-25 16:15:22 01451_replicated_detach_drop_and_quorum_long: [ OK ] 0.47 sec.
2025-06-25 16:15:22 02680_default_star: [ OK ] 0.22 sec.
2025-06-25 16:15:22 00136_duplicate_order_by_elems: [ OK ] 0.27 sec.
2025-06-25 16:15:22 02561_sorting_constants_and_distinct_crash: [ OK ] 1.52 sec.
2025-06-25 16:15:22 00753_alter_destination_for_storage_buffer: [ OK ] 0.32 sec.
2025-06-25 16:15:22 01381_for_each_with_states: [ OK ] 0.27 sec.
2025-06-25 16:15:22 02347_rank_corr_nan: [ OK ] 0.27 sec.
2025-06-25 16:15:22 00847_multiple_join_same_column: [ OK ] 0.42 sec.
2025-06-25 16:15:22 01043_h3_edge_length_m: [ OK ] 0.27 sec.
2025-06-25 16:15:23 02809_prewhere_and_in: [ OK ] 0.42 sec.
2025-06-25 16:15:23 03150_url_hash_non_constant_level: [ OK ] 0.32 sec.
2025-06-25 16:15:23 02675_grant_query_formatting: [ OK ] 0.47 sec.
2025-06-25 16:15:23 02841_parallel_final_wrong_columns_order: [ OK ] 0.92 sec.
2025-06-25 16:15:23 02532_send_logs_level_test: [ SKIPPED ] 0.00 sec.
2025-06-25 16:15:23 Reason: not running for current build
2025-06-25 16:15:23 02292_nested_not_flattened_detach: [ OK ] 0.22 sec.
2025-06-25 16:15:23 01410_nullable_key_and_index: [ OK ] 0.57 sec.
2025-06-25 16:15:23 00045_sorting_by_fixed_string_descending: [ OK ] 0.22 sec.
2025-06-25 16:15:23 02359_send_logs_source_regexp: [ OK ] 0.68 sec.
2025-06-25 16:15:23 01660_join_or_inner: [ OK ] 0.37 sec.
2025-06-25 16:15:24 02021_prewhere_column_optimization: [ OK ] 0.27 sec.
2025-06-25 16:15:24 02833_url_without_path_encoding: [ OK ] 0.97 sec.
2025-06-25 16:15:24 02267_file_globs_schema_inference: [ OK ] 1.92 sec.
2025-06-25 16:15:24 02896_cyclic_aliases_crash: [ OK ] 0.37 sec.
2025-06-25 16:15:24 01470_explain: [ OK ] 0.27 sec.
2025-06-25 16:15:24 02341_global_join_cte: [ OK ] 0.42 sec.
2025-06-25 16:15:24 03022_alter_materialized_view_query_has_inner_table: [ OK ] 0.32 sec.
2025-06-25 16:15:24 02287_ephemeral_format_crash: [ OK ] 0.27 sec.
2025-06-25 16:15:24 00978_sum_map_bugfix: [ OK ] 0.32 sec.
2025-06-25 16:15:25 01056_prepared_statements_null_and_escaping: [ OK ] 0.53 sec.
2025-06-25 16:15:25 02133_final_prewhere_where_lowcardinality_replacing: [ OK ] 0.27 sec.
2025-06-25 16:15:25 00833_sleep_overflow: [ OK ] 0.22 sec.
2025-06-25 16:15:25 01600_encode_XML: [ OK ] 0.23 sec.
2025-06-25 16:15:25 01523_client_local_queries_file_parameter: [ OK ] 1.47 sec.
2025-06-25 16:15:25 02242_throw_if_constant_argument: [ OK ] 0.22 sec.
2025-06-25 16:15:25 00989_parallel_parts_loading: [ OK ] 1.73 sec.
2025-06-25 16:15:25 02543_alter_update_rename_stuck: [ OK ] 5.33 sec.
2025-06-25 16:15:25 02486_truncate_and_unexpected_parts: [ OK ] 0.82 sec.
2025-06-25 16:15:25 01009_global_array_join_names: [ OK ] 0.27 sec.
2025-06-25 16:15:25 02366_kql_func_math: [ OK ] 0.32 sec.
2025-06-25 16:15:25 02570_fallback_from_async_insert: [ OK ] 2.48 sec.
2025-06-25 16:15:26 00950_bad_alloc_when_truncate_join_storage: [ OK ] 0.22 sec.
2025-06-25 16:15:26 02267_special_operator_parse_alias_check: [ OK ] 0.42 sec.
2025-06-25 16:15:26 01259_combinator_distinct: [ OK ] 0.27 sec.
2025-06-25 16:15:26 02265_column_ttl: [ OK ] 0.52 sec.
2025-06-25 16:15:26 01156_pcg_deserialization: [ OK ] 7.64 sec.
2025-06-25 16:15:26 01685_json_extract_double_as_float: [ OK ] 0.22 sec.
2025-06-25 16:15:26 02861_filter_pushdown_const_bug: [ OK ] 0.32 sec.
2025-06-25 16:15:26 00700_to_decimal_or_something_1: [ OK ] 0.87 sec.
2025-06-25 16:15:26 01600_multiple_left_join_with_aliases: [ OK ] 0.27 sec.
2025-06-25 16:15:26 02242_if_then_else_null_bug: [ OK ] 0.27 sec.
2025-06-25 16:15:26 02693_multiple_joins_in: [ OK ] 0.27 sec.
2025-06-25 16:15:26 01018_ddl_dictionaries_special: [ OK ] 0.47 sec.
2025-06-25 16:15:26 02032_short_circuit_least_greatest_bug: [ OK ] 0.22 sec.
2025-06-25 16:15:26 03065_analyzer_cross_join_and_array_join: [ OK ] 0.22 sec.
2025-06-25 16:15:26 00236_replicated_drop_on_non_leader_zookeeper_long: [ OK ] 0.37 sec.
2025-06-25 16:15:26 01946_profile_sleep: [ OK ] 0.68 sec.
2025-06-25 16:15:26 01406_carriage_return_in_tsv_csv: [ OK ] 1.17 sec.
2025-06-25 16:15:27 01416_join_totals_header_bug: [ OK ] 0.27 sec.
2025-06-25 16:15:27 01747_alter_partition_key_enum_zookeeper_long: [ OK ] 0.42 sec.
2025-06-25 16:15:27 00384_column_aggregate_function_insert_from: [ OK ] 0.27 sec.
2025-06-25 16:15:27 03145_unicode_quotes: [ OK ] 0.22 sec.
2025-06-25 16:15:27 03047_analyzer_alias_join: [ OK ] 0.22 sec.
2025-06-25 16:15:27 00080_show_tables_and_system_tables: [ OK ] 0.27 sec.
2025-06-25 16:15:27 01388_clear_all_columns: [ OK ] 0.37 sec.
2025-06-25 16:15:27 00848_join_use_nulls_segfault: [ OK ] 0.47 sec.
2025-06-25 16:15:27 00542_access_to_temporary_table_in_readonly_mode: [ OK ] 0.22 sec.
2025-06-25 16:15:27 02337_join_analyze_stuck: [ OK ] 0.42 sec.
2025-06-25 16:15:27 00732_quorum_insert_simple_test_2_parts_zookeeper_long: [ OK ] 0.42 sec.
2025-06-25 16:15:27 03165_string_functions_with_token_text_indexes: [ OK ] 0.57 sec.
2025-06-25 16:15:28 02475_or_function_alias_and_const_where: [ OK ] 0.22 sec.
2025-06-25 16:15:28 02908_Npy_files_caching: [ OK ] 1.07 sec.
2025-06-25 16:15:28 01825_type_json_1: [ OK ] 0.42 sec.
2025-06-25 16:15:28 00976_max_execution_speed: [ OK ] 3.17 sec.
2025-06-25 16:15:28 03043_group_array_result_is_expected: [ OK ] 0.27 sec.
2025-06-25 16:15:28 02933_sqid: [ OK ] 1.12 sec.
2025-06-25 16:15:28 03206_is_null_constant_result_old_analyzer_bug: [ OK ] 0.27 sec.
2025-06-25 16:15:28 01710_aggregate_projection_with_monotonic_key_expr: [ OK ] 0.27 sec.
2025-06-25 16:15:28 00811_garbage: [ OK ] 0.27 sec.
2025-06-25 16:15:29 01825_type_json_mutations: [ OK ] 0.32 sec.
2025-06-25 16:15:29 01139_asof_join_types: [ OK ] 0.32 sec.
2025-06-25 16:15:29 02479_if_with_null_and_cullable_const: [ OK ] 0.22 sec.
2025-06-25 16:15:29 00251_has_types: [ OK ] 0.32 sec.
2025-06-25 16:15:29 00955_complex_prepared_statements: [ OK ] 2.57 sec.
2025-06-25 16:15:29 01956_skip_unavailable_shards_excessive_attempts: [ OK ] 0.97 sec.
2025-06-25 16:15:29 01276_random_string: [ OK ] 0.82 sec.
2025-06-25 16:15:29 03003_compatibility_setting_bad_value: [ OK ] 0.22 sec.
2025-06-25 16:15:29 02243_in_ip_address: [ OK ] 0.27 sec.
2025-06-25 16:15:30 01119_optimize_trivial_insert_select: [ OK ] 0.37 sec.
2025-06-25 16:15:30 01010_pmj_skip_blocks: [ OK ] 0.62 sec.
2025-06-25 16:15:31 00753_alter_attach: [ OK ] 0.77 sec.
2025-06-25 16:15:31 00113_shard_group_array: [ OK ] 1.67 sec.
2025-06-25 16:15:31 02734_big_int_from_float_ubsan: [ OK ] 0.22 sec.
2025-06-25 16:15:31 02876_yyyymmddhhmmsstodatetime: [ OK ] 0.62 sec.
2025-06-25 16:15:31 02943_tokenbf_and_ngrambf_indexes_support_match_function: [ OK ] 0.37 sec.
2025-06-25 16:15:32 00622_select_in_parens: [ OK ] 0.22 sec.
2025-06-25 16:15:32 01077_mutations_index_consistency: [ OK ] 2.32 sec.
2025-06-25 16:15:32 02893_bad_sample_view: [ OK ] 0.22 sec.
2025-06-25 16:15:32 02890_partition_prune_in_extra_columns: [ OK ] 0.23 sec.
2025-06-25 16:15:32 02908_table_ttl_dependency: [ OK ] 0.88 sec.
2025-06-25 16:15:32 02494_zero_copy_and_projection_and_mutation_work_together: [ OK ] 5.53 sec.
2025-06-25 16:15:32 00753_comment_columns_zookeeper: [ OK ] 0.27 sec.
2025-06-25 16:15:32 03037_dynamic_merges_2_vertical_compact_merge_tree: [ OK ] 0.47 sec.
2025-06-25 16:15:33 02725_object_column_alter: [ OK ] 0.22 sec.
2025-06-25 16:15:33 02375_scalar_lc_cte: [ OK ] 0.27 sec.
2025-06-25 16:15:33 03159_dynamic_type_all_types: [ OK ] 0.42 sec.
2025-06-25 16:15:33 01403_datetime64_constant_arg: [ OK ] 0.27 sec.
2025-06-25 16:15:33 00952_input_function: [ OK ] 5.88 sec.
2025-06-25 16:15:33 02811_csv_input_field_type_mismatch: [ OK ] 1.37 sec.
2025-06-25 16:15:33 02874_parse_json_as_json_each_row_on_no_metadata: [ OK ] 0.22 sec.
2025-06-25 16:15:33 01084_regexp_empty: [ OK ] 0.27 sec.
2025-06-25 16:15:33 01283_max_threads_simple_query_optimization: [ OK ] 0.38 sec.
2025-06-25 16:15:33 02045_like_function: [ OK ] 0.22 sec.
2025-06-25 16:15:34 02422_read_numbers_as_strings: [ OK ] 0.22 sec.
2025-06-25 16:15:34 01432_parse_date_time_best_effort_timestamp: [ OK ] 0.27 sec.
2025-06-25 16:15:34 00652_replicated_mutations_default_database_zookeeper: [ OK ] 1.32 sec.
2025-06-25 16:15:34 03215_view_with_recursive: [ OK ] 0.47 sec.
2025-06-25 16:15:34 00665_alter_nullable_string_to_nullable_uint8: [ OK ] 0.32 sec.
2025-06-25 16:15:34 01328_bad_peephole_optimization: [ OK ] 0.22 sec.
2025-06-25 16:15:34 01949_heredoc_unfinished: [ OK ] 0.52 sec.
2025-06-25 16:15:34 00506_union_distributed: [ OK ] 0.42 sec.
2025-06-25 16:15:34 01602_runningConcurrency: [ OK ] 0.37 sec.
2025-06-25 16:15:34 01116_cross_count_asterisks: [ OK ] 0.27 sec.
2025-06-25 16:15:35 02560_analyzer_materialized_view: [ OK ] 0.42 sec.
2025-06-25 16:15:35 02590_interserver_mode_client_info_initial_query_start_time: [ OK ] 5.43 sec.
2025-06-25 16:15:35 00804_rollup_with_having: [ OK ] 0.27 sec.
2025-06-25 16:15:35 00521_multidimensional: [ OK ] 0.42 sec.
2025-06-25 16:15:35 00760_insert_json_with_defaults: [ OK ] 0.42 sec.
2025-06-25 16:15:35 01093_cyclic_defaults_filimonov: [ OK ] 0.27 sec.
2025-06-25 16:15:35 02560_window_ntile: [ OK ] 0.43 sec.
2025-06-25 16:15:35 03221_merge_profile_events: [ OK ] 0.67 sec.
2025-06-25 16:15:35 01521_max_length_alias: [ OK ] 0.32 sec.
2025-06-25 16:15:35 02949_parallel_replicas_scalar_subquery_big_integer: [ OK ] 0.27 sec.
2025-06-25 16:15:36 02010_array_index_bad_cast: [ OK ] 0.22 sec.
2025-06-25 16:15:36 01121_remote_scalar_subquery: [ OK ] 0.27 sec.
2025-06-25 16:15:36 01063_create_column_set: [ OK ] 0.27 sec.
2025-06-25 16:15:36 02423_ddl_for_opentelemetry: [ OK ] 6.04 sec.
2025-06-25 16:15:36 01283_strict_resize_bug: [ OK ] 0.67 sec.
2025-06-25 16:15:36 02911_add_index_and_materialize_index: [ OK ] 0.22 sec.
2025-06-25 16:15:36 02426_pod_array_overflow_2: [ OK ] 0.22 sec.
2025-06-25 16:15:36 01276_system_licenses: [ OK ] 0.27 sec.
2025-06-25 16:15:36 02995_index_3: [ SKIPPED ] 0.00 sec.
2025-06-25 16:15:36 Reason: not running for current build
2025-06-25 16:15:36 00831_quantile_weighted_parameter_check: [ OK ] 0.27 sec.
2025-06-25 16:15:36 02785_global_join_too_many_columns: [ OK ] 0.32 sec.
2025-06-25 16:15:36 00409_shard_limit_by: [ OK ] 0.42 sec.
2025-06-25 16:15:36 01107_tuples_arrays_parsing_exceptions: [ OK ] 0.72 sec.
2025-06-25 16:15:36 00232_format_readable_decimal_size: [ OK ] 0.22 sec.
2025-06-25 16:15:36 02232_partition_pruner_mixed_constant_type: [ OK ] 0.27 sec.
2025-06-25 16:15:37 01732_union_and_union_all: [ OK ] 0.22 sec.
2025-06-25 16:15:37 02356_insert_query_log_metrics: [ OK ] 0.47 sec.
2025-06-25 16:15:37 03033_set_index_in: [ OK ] 0.57 sec.
2025-06-25 16:15:37 00910_zookeeper_test_alter_compression_codecs_long: [ OK ] 0.68 sec.
2025-06-25 16:15:37 01623_byte_size_const: [ OK ] 0.22 sec.
2025-06-25 16:15:38 01317_no_password_in_command_line: [ OK ] 3.68 sec.
2025-06-25 16:15:38 02933_group_by_memory_usage: [ OK ] 1.37 sec.
2025-06-25 16:15:38 01067_join_null: [ OK ] 0.22 sec.
2025-06-25 16:15:38 01196_max_parser_depth: [ OK ] 0.83 sec.
2025-06-25 16:15:38 03018_external_with_complex_data_types: [ OK ] 0.67 sec.
2025-06-25 16:15:38 02240_get_type_serialization_streams: [ OK ] 0.27 sec.
2025-06-25 16:15:38 01050_group_array_sample: [ OK ] 0.27 sec.
2025-06-25 16:15:38 02789_functions_after_sorting_and_columns_with_same_names_bug_2: [ OK ] 0.32 sec.
2025-06-25 16:15:38 01083_aggregation_memory_efficient_bug: [ OK ] 0.42 sec.
2025-06-25 16:15:38 02302_projections_GROUP_BY_ORDERY_BY_optimize_aggregation_in_order: [ OK ] 0.32 sec.
2025-06-25 16:15:38 02007_join_use_nulls: [ OK ] 0.32 sec.
2025-06-25 16:15:39 02179_degrees_radians: [ OK ] 0.32 sec.
2025-06-25 16:15:39 02956_clickhouse_local_system_parts: [ OK ] 0.72 sec.
2025-06-25 16:15:39 02319_dict_get_check_arguments_size: [ OK ] 0.32 sec.
2025-06-25 16:15:39 02493_do_not_assume_that_the_original_query_was_valid_when_transforming_joins: [ OK ] 0.27 sec.
2025-06-25 16:15:39 02358_file_default_value: [ OK ] 0.92 sec.
2025-06-25 16:15:39 01774_tuple_null_in: [ OK ] 0.22 sec.
2025-06-25 16:15:39 02841_not_ready_set_constraints: [ OK ] 0.37 sec.
2025-06-25 16:15:39 00799_function_dry_run: [ OK ] 0.27 sec.
2025-06-25 16:15:39 00417_kill_query: [ OK ] 2.63 sec.
2025-06-25 16:15:39 01259_datetime64_ubsan: [ OK ] 0.27 sec.
2025-06-25 16:15:39 03149_variant_pop_back_typo: [ OK ] 0.22 sec.
2025-06-25 16:15:39 00577_full_join_segfault: [ OK ] 0.27 sec.
2025-06-25 16:15:39 00809_add_days_segfault: [ OK ] 0.27 sec.
2025-06-25 16:15:40 02963_test_flexible_disk_configuration: [ OK ] 0.67 sec.
2025-06-25 16:15:40 01710_projection_optimize_group_by_function_keys: [ OK ] 0.27 sec.
2025-06-25 16:15:40 01710_normal_projection_with_query_plan_optimization: [ OK ] 0.32 sec.
2025-06-25 16:15:40 03093_reading_bug_with_parallel_replicas: [ OK ] 0.42 sec.
2025-06-25 16:15:40 00740_optimize_predicate_expression: [ OK ] 0.32 sec.
2025-06-25 16:15:40 02941_variant_type_2: [ OK ] 6.68 sec.
2025-06-25 16:15:40 01755_shard_pruning_with_literal: [ OK ] 0.32 sec.
2025-06-25 16:15:40 02366_kql_operator_in_sql: [ OK ] 0.37 sec.
2025-06-25 16:15:40 03262_analyzer_materialized_view_in_with_cte: [ OK ] 0.27 sec.
2025-06-25 16:15:40 01607_arrays_as_nested_csv: [ OK ] 1.42 sec.
2025-06-25 16:15:41 02317_functions_with_nothing: [ OK ] 0.32 sec.
2025-06-25 16:15:41 01659_test_base64Decode_mysql_compatibility: [ OK ] 0.22 sec.
2025-06-25 16:15:41 02180_group_by_lowcardinality: [ OK ] 0.17 sec.
2025-06-25 16:15:41 02366_kql_distinct: [ OK ] 0.27 sec.
2025-06-25 16:15:41 01355_alter_column_with_order: [ OK ] 0.32 sec.
2025-06-25 16:15:41 00712_prewhere_with_alias_bug_2: [ OK ] 0.27 sec.
2025-06-25 16:15:41 01073_show_tables_not_like: [ OK ] 0.37 sec.
2025-06-25 16:15:41 00534_functions_bad_arguments2: [ SKIPPED ] 0.00 sec.
2025-06-25 16:15:41 Reason: not running for current build
2025-06-25 16:15:41 02578_ipv4_codec_t64: [ OK ] 0.22 sec.
2025-06-25 16:15:41 02475_analysis_of_variance: [ OK ] 0.32 sec.
2025-06-25 16:15:41 01302_polygons_distance: [ OK ] 0.27 sec.
2025-06-25 16:15:41 01011_test_create_as_skip_indices: [ OK ] 0.27 sec.
2025-06-25 16:15:42 03006_join_on_inequal_expression_2: [ OK ] 0.97 sec.
2025-06-25 16:15:42 02992_analyzer_group_by_const: [ OK ] 0.47 sec.
2025-06-25 16:15:42 00834_kill_mutation_replicated_zookeeper: [ SKIPPED ] 0.00 sec.
2025-06-25 16:15:42 Reason: not running for current build
2025-06-25 16:15:42 02383_arrow_dict_special_cases: [ OK ] 2.57 sec.
2025-06-25 16:15:42 01558_transform_null_in: [ OK ] 0.32 sec.
2025-06-25 16:15:43 01622_constraints_simple_optimization: [ OK ] 0.72 sec.
2025-06-25 16:15:43 00732_decimal_summing_merge_tree: [ OK ] 0.32 sec.
2025-06-25 16:15:43 02861_alter_replace_partition_do_not_wait_mutations_on_unrelated_partitions: [ OK ] 2.97 sec.
2025-06-25 16:15:43 02735_system_zookeeper_connection: [ OK ] 0.32 sec.
2025-06-25 16:15:43 01043_categorical_iv: [ OK ] 0.37 sec.
2025-06-25 16:15:43 01051_window_view_parser_hop: [ OK ] 0.47 sec.
2025-06-25 16:15:43 01739_index_hint: [ OK ] 0.42 sec.
2025-06-25 16:15:43 00700_to_decimal_or_something: [ OK ] 0.57 sec.
2025-06-25 16:15:44 02971_limit_by_distributed: [ OK ] 0.27 sec.
2025-06-25 16:15:44 03208_inconsistent_formatting_of_not_subquery: [ OK ] 0.42 sec.
2025-06-25 16:15:44 01655_sleep_infinite_float: [ OK ] 0.22 sec.
2025-06-25 16:15:44 00265_http_content_type_format_timezone: [ OK ] 0.82 sec.
2025-06-25 16:15:44 00105_shard_collations: [ OK ] 0.32 sec.
2025-06-25 16:15:45 01049_zookeeper_synchronous_mutations_long: [ OK ] 0.42 sec.
2025-06-25 16:15:46 02534_parquet_fixed_binary_array: [ OK ] 1.58 sec.
2025-06-25 16:15:46 00517_date_parsing: [ OK ] 0.42 sec.
2025-06-25 16:15:46 02790_async_queries_in_query_log: [ OK ] 4.78 sec.
2025-06-25 16:15:47 01648_mutations_and_escaping: [ OK ] 5.29 sec.
2025-06-25 16:15:47 02233_interpolate_1: [ OK ] 0.37 sec.
2025-06-25 16:15:47 00966_invalid_json_must_not_parse: [ OK ] 0.27 sec.
2025-06-25 16:15:47 01766_todatetime64_no_timezone_arg: [ OK ] 0.22 sec.
2025-06-25 16:15:47 02020_cast_integer_overflow: [ OK ] 0.22 sec.
2025-06-25 16:15:47 01518_nullable_aggregate_states1: [ OK ] 0.27 sec.
2025-06-25 16:15:48 00945_bloom_filter_index: [ OK ] 3.58 sec.
2025-06-25 16:15:48 02476_fix_cast_parser_bug: [ OK ] 0.22 sec.
2025-06-25 16:15:48 00564_temporary_table_management: [ OK ] 0.22 sec.
2025-06-25 16:15:48 01954_clickhouse_benchmark_multiple_long: [ OK ] 6.54 sec.
2025-06-25 16:15:48 02111_global_context_temporary_tables: [ OK ] 0.27 sec.
2025-06-25 16:15:48 02515_and_or_if_multiif_not_return_lc: [ OK ] 0.27 sec.
2025-06-25 16:15:48 00487_if_array_fixed_string: [ OK ] 0.27 sec.
2025-06-25 16:15:48 02715_or_null: [ OK ] 0.27 sec.
2025-06-25 16:15:48 01917_system_data_skipping_indices: [ OK ] 0.32 sec.
2025-06-25 16:15:48 01673_test_toMinute_mysql_dialect: [ OK ] 0.22 sec.
2025-06-25 16:15:48 01508_explain_header: [ OK ] 0.22 sec.
2025-06-25 16:15:49 02982_dont_infer_exponent_floats: [ OK ] 0.27 sec.
2025-06-25 16:15:49 02245_s3_schema_desc: [ OK ] 0.37 sec.
2025-06-25 16:15:49 03199_join_with_materialized_column: [ OK ] 0.28 sec.
2025-06-25 16:15:49 01511_different_expression_with_same_alias: [ OK ] 0.32 sec.
2025-06-25 16:15:49 01290_max_execution_speed_distributed: [ OK ] 2.63 sec.
2025-06-25 16:15:49 00794_materialized_view_with_column_defaults: [ OK ] 0.32 sec.
2025-06-25 16:15:49 02013_emptystring_cast: [ OK ] 0.32 sec.
2025-06-25 16:15:49 02494_analyzer_compound_expression_crash_fix: [ OK ] 0.32 sec.
2025-06-25 16:15:49 00897_flatten: [ OK ] 0.32 sec.
2025-06-25 16:15:50 01720_join_implicit_cast: [ OK ] 1.07 sec.
2025-06-25 16:15:50 00700_decimal_defaults: [ OK ] 0.32 sec.
2025-06-25 16:15:50 01832_memory_write_suffix: [ OK ] 0.22 sec.
2025-06-25 16:15:50 02922_server_exit_code: [ OK ] 0.67 sec.
2025-06-25 16:15:50 02764_csv_trim_whitespaces: [ OK ] 11.80 sec.
2025-06-25 16:15:50 01761_cast_to_enum_nullable: [ OK ] 0.22 sec.
2025-06-25 16:15:50 02336_sort_optimization_with_fill: [ OK ] 0.27 sec.
2025-06-25 16:15:50 02688_aggregate_states: [ OK ] 0.42 sec.
2025-06-25 16:15:50 02400_memory_accounting_on_error: [ OK ] 0.32 sec.
2025-06-25 16:15:51 00626_replace_partition_from_table_zookeeper: [ OK ] 23.59 sec.
2025-06-25 16:15:51 01935_parametrized_query_parametric_aggregate_function: [ OK ] 0.42 sec.
2025-06-25 16:15:51 02923_cte_equality_disjunction: [ OK ] 0.22 sec.
2025-06-25 16:15:51 02142_http_with_query_parameters: [ OK ] 0.47 sec.
2025-06-25 16:15:51 02724_mutliple_storage_join: [ OK ] 0.32 sec.
2025-06-25 16:15:51 02674_trivial_count_analyzer: [ OK ] 0.42 sec.
2025-06-25 16:15:51 02877_optimize_read_in_order_from_view: [ OK ] 1.87 sec.
2025-06-25 16:15:51 00402_nan_and_extremes: [ OK ] 0.27 sec.
2025-06-25 16:15:51 01376_array_fill_empty: [ OK ] 0.27 sec.
2025-06-25 16:15:51 01188_attach_table_from_path: [ OK ] 0.37 sec.
2025-06-25 16:15:52 01845_add_testcase_for_arrayElement: [ OK ] 0.27 sec.
2025-06-25 16:15:52 01710_projection_aggregate_functions_null_for_empty: [ OK ] 0.27 sec.
2025-06-25 16:15:52 02049_clickhouse_local_merge_tree: [ OK ] 0.69 sec.
2025-06-25 16:15:52 02661_read_from_archive_targz: [ OK ] 7.39 sec.
2025-06-25 16:15:52 01662_date_ubsan: [ OK ] 0.43 sec.
2025-06-25 16:15:52 02711_server_uuid_macro: [ OK ] 0.37 sec.
2025-06-25 16:15:52 01354_order_by_tuple_collate_const: [ OK ] 0.22 sec.
2025-06-25 16:15:52 01356_initialize_aggregation: [ OK ] 0.27 sec.
2025-06-25 16:15:52 02988_ordinary_database_warning: [ OK ] 0.27 sec.
2025-06-25 16:15:53 02552_client_format_settings: [ OK ] 0.22 sec.
2025-06-25 16:15:53 01851_array_difference_decimal_overflow_ubsan: [ OK ] 0.32 sec.
2025-06-25 16:15:53 02316_const_string_intersact: [ OK ] 0.22 sec.
2025-06-25 16:15:53 02987_group_array_intersect: [ OK ] 1.12 sec.
2025-06-25 16:15:53 03215_varian_as_common_type_tuple_map: [ OK ] 0.22 sec.
2025-06-25 16:15:53 02566_analyzer_limit_settings_distributed: [ OK ] 0.37 sec.
2025-06-25 16:15:53 01081_window_view_target_table_engine: [ OK ] 1.73 sec.
2025-06-25 16:15:53 02845_arrayShiftRotate: [ OK ] 0.42 sec.
2025-06-25 16:15:53 02475_join_bug_42832: [ OK ] 0.32 sec.
2025-06-25 16:15:53 03167_base64_url_functions: [ OK ] 0.27 sec.
2025-06-25 16:15:53 02521_analyzer_array_join_crash: [ OK ] 0.32 sec.
2025-06-25 16:15:53 01921_with_fill_with_totals: [ OK ] 0.27 sec.
2025-06-25 16:15:53 03053_analyzer_join_alias: [ OK ] 0.27 sec.
2025-06-25 16:15:53 01825_type_json_ephemeral: [ OK ] 0.27 sec.
2025-06-25 16:15:54 03165_distinct_with_window_func_crash: [ OK ] 0.27 sec.
2025-06-25 16:15:54 02372_now_in_block: [ OK ] 0.42 sec.
2025-06-25 16:15:54 01646_fix_window_funnel_inconistency: [ OK ] 0.32 sec.
2025-06-25 16:15:54 02902_select_subcolumns_from_engine_null: [ OK ] 0.27 sec.
2025-06-25 16:15:54 02973_analyzer_join_use_nulls_column_not_found: [ OK ] 0.27 sec.
2025-06-25 16:15:54 00229_prewhere_column_missing: [ OK ] 0.42 sec.
2025-06-25 16:15:54 02016_bit_shift_right_for_string_integer: [ OK ] 0.72 sec.
2025-06-25 16:15:54 03215_validate_type_in_alter_add_modify_column: [ OK ] 0.37 sec.
2025-06-25 16:15:54 02497_having_without_actual_aggregation_bug: [ OK ] 0.32 sec.
2025-06-25 16:15:54 01825_type_json_18: [ OK ] 0.32 sec.
2025-06-25 16:15:54 02998_analyzer_secret_args_tree_node: [ OK ] 0.27 sec.
2025-06-25 16:15:54 00396_uuid: [ OK ] 0.27 sec.
2025-06-25 16:15:54 03224_json_merges_new_type_in_shared_data: [ OK ] 0.37 sec.
2025-06-25 16:15:54 02835_fuzz_remove_redundant_sorting: [ OK ] 0.42 sec.
2025-06-25 16:15:55 02985_if_over_big_int_decimal: [ OK ] 0.32 sec.
2025-06-25 16:15:55 00002_system_numbers: [ OK ] 0.27 sec.
2025-06-25 16:15:55 02967_fuzz_bad_cast: [ OK ] 0.27 sec.
2025-06-25 16:15:55 01848_partition_value_column: [ OK ] 0.37 sec.
2025-06-25 16:15:55 02973_block_number_sparse_serialization_and_mutation: [ OK ] 0.47 sec.
2025-06-25 16:15:55 00606_quantiles_and_nans: [ OK ] 0.22 sec.
2025-06-25 16:15:55 01662_join_mixed: [ OK ] 0.22 sec.
2025-06-25 16:15:55 01837_cast_to_array_from_empty_array: [ OK ] 0.22 sec.
2025-06-25 16:15:55 02324_map_combinator_bug: [ OK ] 0.32 sec.
2025-06-25 16:15:55 02521_incorrect_dealy_for_insert_bug_44902: [ OK ] 7.64 sec.
2025-06-25 16:15:55 01513_defaults_on_defaults_no_column: [ OK ] 0.32 sec.
2025-06-25 16:15:55 03033_cte_numbers_memory: [ OK ] 0.27 sec.
2025-06-25 16:15:55 03299_deep_nested_map_creation: [ OK ] 0.27 sec.
2025-06-25 16:15:56 02006_use_constants_in_with_and_select: [ OK ] 0.27 sec.
2025-06-25 16:15:56 02915_analyzer_fuzz_5: [ OK ] 0.22 sec.
2025-06-25 16:15:56 02366_kql_tabular: [ OK ] 0.42 sec.
2025-06-25 16:15:56 03111_inner_join_group_by: [ OK ] 0.22 sec.
2025-06-25 16:15:56 02096_bad_options_in_client_and_local: [ OK ] 1.02 sec.
2025-06-25 16:15:57 01039_mergetree_exec_time: [ OK ] 1.28 sec.
2025-06-25 16:15:57 02556_local_with_totals_and_extremes: [ OK ] 0.47 sec.
2025-06-25 16:15:57 00440_nulls_merge_tree: [ OK ] 0.22 sec.
2025-06-25 16:15:57 03203_variant_convert_field_to_type_bug: [ OK ] 0.22 sec.
2025-06-25 16:15:57 01702_system_numbers_scientific_notation: [ OK ] 0.27 sec.
2025-06-25 16:15:57 02920_rename_column_of_skip_indices: [ OK ] 0.32 sec.
2025-06-25 16:15:57 00482_subqueries_and_aliases: [ OK ] 0.22 sec.
2025-06-25 16:15:57 02918_parallel_replicas_custom_key_unavailable_replica: [ OK ] 0.27 sec.
2025-06-25 16:15:57 03032_numbers_zeros: [ OK ] 0.27 sec.
2025-06-25 16:15:57 00999_join_not_nullable_types: [ OK ] 0.22 sec.
2025-06-25 16:15:57 00338_replicate_array_of_strings: [ OK ] 0.27 sec.
2025-06-25 16:15:58 01781_token_extractor_buffer_overflow: [ OK ] 0.37 sec.
2025-06-25 16:15:58 00752_low_cardinality_array_result: [ OK ] 0.22 sec.
2025-06-25 16:15:58 00803_odbc_driver_2_format: [ OK ] 0.22 sec.
2025-06-25 16:15:58 02025_having_filter_column: [ OK ] 0.22 sec.
2025-06-25 16:15:58 02809_has_subsequence: [ OK ] 0.47 sec.
2025-06-25 16:15:58 00800_versatile_storage_join: [ OK ] 0.32 sec.
2025-06-25 16:15:58 02950_part_log_bytes_uncompressed: [ OK ] 0.27 sec.
2025-06-25 16:15:58 01902_table_function_merge_db_params: [ OK ] 0.27 sec.
2025-06-25 16:15:58 01655_window_functions_bug: [ OK ] 0.22 sec.
2025-06-25 16:15:58 02423_insert_stats_behaviour: [ OK ] 2.77 sec.
2025-06-25 16:15:58 02355_column_type_name_lc: [ OK ] 0.22 sec.
2025-06-25 16:15:59 00647_multiply_aggregation_state: [ OK ] 0.37 sec.
2025-06-25 16:15:59 01262_low_cardinality_remove: [ OK ] 0.27 sec.
2025-06-25 16:15:59 01942_untuple_transformers_msan: [ OK ] 0.22 sec.
2025-06-25 16:15:59 00978_ml_math: [ OK ] 0.22 sec.
2025-06-25 16:15:59 02565_analyzer_limit_settings: [ OK ] 0.32 sec.
2025-06-25 16:15:59 00975_json_hang: [ OK ] 0.37 sec.
2025-06-25 16:15:59 03207_composite_expressions_lambda_consistent_formatting: [ OK ] 0.27 sec.
2025-06-25 16:16:00 00580_cast_nullable_to_non_nullable: [ OK ] 0.22 sec.
2025-06-25 16:16:01 00746_compile_non_deterministic_function: [ OK ] 6.28 sec.
2025-06-25 16:16:02 03023_invalid_format_detection: [ OK ] 0.52 sec.
2025-06-25 16:16:03 01338_long_select_and_alter: [ OK ] 13.26 sec.
2025-06-25 16:16:04 01071_window_view_event_tumble_asc_join: [ OK ] 1.72 sec.
2025-06-25 16:16:04 03037_union_view: [ OK ] 0.27 sec.
2025-06-25 16:16:04 02421_truncate_isolation_with_mutations: [ OK ] 13.90 sec.
2025-06-25 16:16:04 02896_max_execution_time_with_break_overflow_mode: [ OK ] 5.23 sec.
2025-06-25 16:16:04 02918_template_format_deadlock: [ OK ] 0.47 sec.
2025-06-25 16:16:04 02122_join_group_by_timeout: [ OK ] 5.58 sec.
2025-06-25 16:16:04 03164_early_constant_folding_analyzer: [ OK ] 0.22 sec.
2025-06-25 16:16:05 01100_split_by_string: [ OK ] 0.27 sec.
2025-06-25 16:16:05 03008_filter_projections_non_deterministoc_functions: [ OK ] 0.42 sec.
2025-06-25 16:16:05 02981_translate_fixedstring: [ OK ] 0.22 sec.
2025-06-25 16:16:05 01632_tinylog_read_write: [ OK ] 10.35 sec.
2025-06-25 16:16:05 02751_multiquery_with_argument: [ OK ] 1.57 sec.
2025-06-25 16:16:05 00667_compare_arrays_of_different_types: [ OK ] 0.27 sec.
2025-06-25 16:16:05 03115_alias_exists_column: [ OK ] 0.22 sec.
2025-06-25 16:16:05 02714_date_date32_in: [ OK ] 0.22 sec.
2025-06-25 16:16:05 03095_join_filter_push_down_right_stream_filled: [ OK ] 0.27 sec.
2025-06-25 16:16:05 00752_low_cardinality_permute: [ OK ] 0.27 sec.
2025-06-25 16:16:05 01430_modify_sample_by_zookeeper_long: [ OK ] 0.57 sec.
2025-06-25 16:16:06 02477_exists_fuzz_43478: [ OK ] 0.22 sec.
2025-06-25 16:16:06 03008_index_small: [ OK ] 0.27 sec.
2025-06-25 16:16:06 01069_insert_float_as_nullable_unit8: [ OK ] 0.22 sec.
2025-06-25 16:16:06 01680_date_time_add_ubsan: [ OK ] 0.27 sec.
2025-06-25 16:16:06 01548_with_totals_having: [ OK ] 0.23 sec.
2025-06-25 16:16:06 00986_materialized_view_stack_overflow: [ OK ] 0.52 sec.
2025-06-25 16:16:06 02155_parse_date_lowcard_default_throw: [ OK ] 0.22 sec.
2025-06-25 16:16:06 02155_nested_lc_defalut_bug: [ OK ] 0.32 sec.
2025-06-25 16:16:06 02582_analyzer_join_subquery_empty_column_list: [ OK ] 0.27 sec.
2025-06-25 16:16:07 01513_optimize_aggregation_in_order_memory_long: [ OK ] 2.47 sec.
2025-06-25 16:16:07 02021_exponential_sum_shard: [ OK ] 0.47 sec.
2025-06-25 16:16:07 02921_fuzzbits_with_array_join: [ OK ] 0.22 sec.
2025-06-25 16:16:07 02943_variant_element: [ OK ] 0.27 sec.
2025-06-25 16:16:07 02184_ipv6_cast_test: [ OK ] 0.27 sec.
2025-06-25 16:16:07 00411_long_accurate_number_comparison_int2: [ OK ] 7.93 sec.
2025-06-25 16:16:08 00148_summing_merge_tree_aggregate_function: [ OK ] 1.27 sec.
2025-06-25 16:16:08 02353_partition_prune_nullable_key: [ OK ] 0.27 sec.
2025-06-25 16:16:08 02551_obfuscator_keywords: [ OK ] 0.47 sec.
2025-06-25 16:16:08 03147_asof_join_ddb_missing: [ OK ] 0.97 sec.
2025-06-25 16:16:08 02270_errors_in_files: [ OK ] 2.44 sec.
2025-06-25 16:16:08 02150_index_hypothesis_race_long: [ OK ] 4.63 sec.
2025-06-25 16:16:08 02021_map_bloom_filter_index: [ OK ] 0.53 sec.
2025-06-25 16:16:09 01505_trivial_count_with_partition_predicate: [ OK ] 0.38 sec.
2025-06-25 16:16:09 02713_ip4_uint_compare: [ OK ] 0.22 sec.
2025-06-25 16:16:09 00059_shard_global_in: [ OK ] 0.27 sec.
2025-06-25 16:16:09 02803_backup_tmp_files: [ OK ] 1.07 sec.
2025-06-25 16:16:09 01852_hints_enum_name: [ OK ] 0.57 sec.
2025-06-25 16:16:09 02870_per_column_settings: [ OK ] 0.42 sec.
2025-06-25 16:16:09 00054_join_string: [ OK ] 0.22 sec.
2025-06-25 16:16:10 02915_analyzer_fuzz_6: [ OK ] 0.27 sec.
2025-06-25 16:16:10 00185_array_literals: [ OK ] 0.32 sec.
2025-06-25 16:16:10 02493_max_streams_for_merge_tree_reading: [ OK ] 1.87 sec.
2025-06-25 16:16:10 02531_two_level_aggregation_bug: [ OK ] 1.07 sec.
2025-06-25 16:16:10 01656_sequence_next_node_long: [ OK ] 2.23 sec.
2025-06-25 16:16:10 01818_move_partition_simple: [ OK ] 0.32 sec.
2025-06-25 16:16:10 02595_orc_arrow_parquet_more_types: [ OK ] 1.02 sec.
2025-06-25 16:16:10 00753_distributed_system_columns_and_system_tables: [ OK ] 0.27 sec.
2025-06-25 16:16:10 01825_new_type_json_18: [ OK ] 0.27 sec.
2025-06-25 16:16:10 02187_test_final_and_limit_modifier: [ OK ] 0.27 sec.
2025-06-25 16:16:10 02003_compress_bz2: [ OK ] 0.77 sec.
2025-06-25 16:16:10 02477_age: [ OK ] 0.52 sec.
2025-06-25 16:16:10 00334_column_aggregate_function_limit: [ OK ] 0.28 sec.
2025-06-25 16:16:10
2025-06-25 16:16:10 479 tests passed. 4 tests skipped. 496.45 s elapsed (Process-7).
2025-06-25 16:16:11 02133_distributed_queries_formatting: [ OK ] 0.22 sec.
2025-06-25 16:16:11
2025-06-25 16:16:11 488 tests passed. 6 tests skipped. 496.60 s elapsed (Process-8).
2025-06-25 16:16:11 00024_unused_array_join_in_subquery: [ OK ] 0.22 sec.
2025-06-25 16:16:11
2025-06-25 16:16:11 454 tests passed. 4 tests skipped. 496.66 s elapsed (Process-9).
2025-06-25 16:16:11 01944_insert_partition_by: [ OK ] 0.37 sec.
2025-06-25 16:16:11
2025-06-25 16:16:11 197 tests passed. 2 tests skipped. 496.82 s elapsed (Process-5).
2025-06-25 16:16:11 02013_zlib_read_after_eof: [ OK ] 1.87 sec.
2025-06-25 16:16:11
2025-06-25 16:16:11 422 tests passed. 4 tests skipped. 497.46 s elapsed (Process-4).
2025-06-25 16:16:18 02428_parameterized_view: [ OK ] 19.17 sec.
2025-06-25 16:16:18
2025-06-25 16:16:18 467 tests passed. 9 tests skipped. 503.58 s elapsed (Process-10).
2025-06-25 16:16:18 01825_new_type_json_nbagames: [ OK ] 8.79 sec.
2025-06-25 16:16:18
2025-06-25 16:16:18 Having 1 errors! 350 tests passed. 4 tests skipped. 504.46 s elapsed (Process-3).
2025-06-25 16:16:25 00719_parallel_ddl_db: [ OK ] 19.22 sec.
2025-06-25 16:16:25
2025-06-25 16:16:25 Having 1 errors! 350 tests passed. 8 tests skipped. 511.35 s elapsed (Process-6).
2025-06-25 16:16:35 Running 281 stateless tests (MainProcess).
2025-06-25 16:16:38 03231_restore_user_with_existing_role: [ OK ] 3.23 sec.
2025-06-25 16:16:43 03206_replication_lag_metric: [ OK ] 5.33 sec.
2025-06-25 16:16:44 03198_table_function_directory_path: [ OK ] 0.37 sec.
2025-06-25 16:16:44 03198_dynamic_read_subcolumns: [ OK ] 0.37 sec.
2025-06-25 16:16:44 03168_loop_engine_with_parallel_replicas: [ OK ] 0.27 sec.
2025-06-25 16:16:46 03154_lazy_token_iterator: [ OK ] 1.52 sec.
2025-06-25 16:17:02 03151_unload_index_race: [ OK ] 15.91 sec.
2025-06-25 16:17:02 03147_system_columns_access_checks: [ SKIPPED ] 0.00 sec.
2025-06-25 16:17:02 Reason: not running for current build
2025-06-25 16:17:03 03147_parquet_memory_tracking: [ OK ] 0.72 sec.
2025-06-25 16:17:03 03147_table_function_loop: [ OK ] 0.32 sec.
2025-06-25 16:17:50 03008_deduplication_mv_generates_several_blocks_replicated: [ OK ] 46.70 sec.
2025-06-25 16:17:53 03008_s3_plain_rewritable_fault: [ OK ] 3.43 sec.
2025-06-25 16:18:29 03008_deduplication_several_mv_into_one_table_nonreplicated: [ OK ] 36.02 sec.
2025-06-25 16:19:02 03008_deduplication_insert_several_blocks_nonreplicated: [ OK ] 32.66 sec.
2025-06-25 16:19:47 03008_deduplication_insert_several_blocks_replicated: [ OK ] 45.49 sec.
2025-06-25 16:19:49 03002_part_log_rmt_fetch_merge_error: [ OK ] 1.92 sec.
2025-06-25 16:19:55 03002_part_log_rmt_fetch_mutate_error: [ OK ] 5.89 sec.
2025-06-25 16:19:56 02990_rmt_replica_path_uuid: [ OK ] 0.37 sec.
2025-06-25 16:19:58 02980_dist_insert_readonly_replica: [ OK ] 2.13 sec.
2025-06-25 16:20:00 02973_backup_of_in_memory_compressed: [ OK ] 1.82 sec.
2025-06-25 16:20:41 02962_system_sync_replica_lightweight_from_modifier: [ OK ] 41.63 sec.
2025-06-25 16:20:42 02961_drop_tables: [ OK ] 0.47 sec.
2025-06-25 16:20:42 02960_partition_by_udf: [ OK ] 0.32 sec.
2025-06-25 16:20:46 02944_dynamically_change_filesystem_cache_size: [ OK ] 3.33 sec.
2025-06-25 16:20:49 02943_rmt_alter_metadata_merge_checksum_mismatch: [ OK ] 2.98 sec.
2025-06-25 16:20:49 02931_max_num_to_warn: [ OK ] 0.47 sec.
2025-06-25 16:20:53 02916_move_partition_inactive_replica: [ OK ] 3.73 sec.
2025-06-25 16:20:56 02915_move_partition_inactive_replica: [ OK ] 2.93 sec.
2025-06-25 16:20:56 02911_row_policy_on_cluster: [ OK ] 0.62 sec.
2025-06-25 16:20:57 02910_prefetch_unexpceted_exception: [ OK ] 0.22 sec.
2025-06-25 16:20:57 02908_empty_named_collection: [ OK ] 0.27 sec.
2025-06-25 16:21:00 02908_many_requests_to_system_replicas: [ OK ] 2.83 sec.
2025-06-25 16:21:03 02888_replicated_merge_tree_creation: [ OK ] 2.78 sec.
2025-06-25 16:21:04 02887_insert_quorum_wo_keeper_retries: [ OK ] 0.42 sec.
2025-06-25 16:21:04 02884_async_insert_skip_settings: [ OK ] 0.72 sec.
2025-06-25 16:21:06 02884_async_insert_native_protocol_3: [ OK ] 1.98 sec.
2025-06-25 16:21:13 02874_parquet_multiple_batches_array_inconsistent_offsets: [ OK ] 7.19 sec.
2025-06-25 16:21:22 02871_peak_threads_usage: [ OK ] 8.24 sec.
2025-06-25 16:21:22 02867_create_user_ssh: [ OK ] 0.22 sec.
2025-06-25 16:21:22 02863_delayed_source_with_totals_and_extremes: [ OK ] 0.37 sec.
2025-06-25 16:21:24 02845_threads_count_in_distributed_queries: [ OK ] 2.08 sec.
2025-06-25 16:21:25 02843_insertion_table_schema_infer: [ OK ] 0.72 sec.
2025-06-25 16:21:28 02841_parquet_filter_pushdown: [ OK ] 2.83 sec.
2025-06-25 16:21:28 02833_multiprewhere_extra_column: [ OK ] 0.32 sec.
2025-06-25 16:21:31 02808_filesystem_cache_drop_query: [ OK ] 2.28 sec.
2025-06-25 16:21:32 02796_calculate_text_stack_trace: [ OK ] 1.37 sec.
2025-06-25 16:21:35 02789_filesystem_cache_alignment: [ OK ] 3.08 sec.
2025-06-25 16:21:36 02789_table_functions_errors: [ OK ] 1.17 sec.
2025-06-25 16:21:36 02782_uniq_exact_parallel_merging_bug: [ SKIPPED ] 0.00 sec.
2025-06-25 16:21:36 Reason: not running for current build
2025-06-25 16:21:37 02775_show_columns_called_from_mysql: [ OK ] 0.72 sec.
2025-06-25 16:21:37 02762_replicated_database_no_args: [ OK ] 0.27 sec.
2025-06-25 16:21:38 02751_ip_types_aggregate_functions_states: [ OK ] 0.82 sec.
2025-06-25 16:21:39 02736_reading_and_writing_structure_fields: [ OK ] 1.22 sec.
2025-06-25 16:21:40 02735_capnp_case_insensitive_names_matching: [ OK ] 0.72 sec.
2025-06-25 16:21:44 02735_parquet_encoder: [ OK ] 3.93 sec.
2025-06-25 16:21:45 02725_url_support_virtual_column: [ OK ] 0.32 sec.
2025-06-25 16:22:10 02725_start_stop_fetches: [ OK ] 24.99 sec.
2025-06-25 16:22:10 02710_default_replicated_parameters: [ OK ] 0.27 sec.
2025-06-25 16:22:10 02706_show_columns: [ OK ] 0.57 sec.
2025-06-25 16:22:24 02700_s3_part_INT_MAX: [ OK ] 13.66 sec.
2025-06-25 16:22:24 02581_share_big_sets_between_mutation_tasks_long: [ SKIPPED ] 0.00 sec.
2025-06-25 16:22:24 Reason: not running for current build
2025-06-25 16:22:25 02572_system_logs_materialized_views_ignore_errors: [ OK ] 0.62 sec.
2025-06-25 16:22:27 02566_ipv4_ipv6_binary_formats: [ OK ] 2.23 sec.
2025-06-25 16:22:28 02561_temporary_table_sessions: [ OK ] 0.67 sec.
2025-06-25 16:22:28 02541_arrow_duration_type: [ OK ] 0.72 sec.
2025-06-25 16:22:42 02535_max_parallel_replicas_custom_key_mt: [ OK ] 13.31 sec.
2025-06-25 16:22:55 02535_max_parallel_replicas_custom_key_rmt: [ OK ] 13.06 sec.
2025-06-25 16:22:56 02522_avro_complicate_schema: [ OK ] 0.72 sec.
2025-06-25 16:23:17 02515_cleanup_async_insert_block_ids: [ OK ] 21.48 sec.
2025-06-25 16:23:18 02510_orc_map_indexes: [ OK ] 0.78 sec.
2025-06-25 16:23:19 02503_cache_on_write_with_small_segment_size: [ OK ] 1.27 sec.
2025-06-25 16:23:22 02503_insert_storage_snapshot: [ OK ] 2.73 sec.
2025-06-25 16:23:23 02501_deep_recusion_schema_inference: [ OK ] 0.92 sec.
2025-06-25 16:23:23 02497_trace_events_stress_long: [ SKIPPED ] 0.00 sec.
2025-06-25 16:23:23 Reason: not running for current build
2025-06-25 16:23:23 02495_s3_filter_by_file: [ OK ] 0.47 sec.
2025-06-25 16:23:24 02494_query_cache_user_quotas_after_drop: [ OK ] 0.32 sec.
2025-06-25 16:23:24 02494_query_cache_query_log: [ OK ] 0.62 sec.
2025-06-25 16:23:25 02494_query_cache_case_agnostic_matching: [ OK ] 0.42 sec.
2025-06-25 16:23:25 02494_query_cache_compression: [ OK ] 0.37 sec.
2025-06-25 16:23:25 02494_query_cache_totals_extremes: [ OK ] 0.37 sec.
2025-06-25 16:23:26 02494_query_cache_exception_handling: [ OK ] 0.27 sec.
2025-06-25 16:23:26 02494_query_cache_eligible_queries: [ OK ] 0.42 sec.
2025-06-25 16:23:32 02494_query_cache_ttl_long: [ OK ] 6.29 sec.
2025-06-25 16:23:33 02494_query_cache_events: [ OK ] 0.47 sec.
2025-06-25 16:23:35 02494_trace_log_profile_events: [ OK ] 1.93 sec.
2025-06-25 16:23:35 02494_query_cache_bugs: [ OK ] 0.32 sec.
2025-06-25 16:23:36 02494_query_cache_squash_partial_results: [ OK ] 0.42 sec.
2025-06-25 16:23:36 02484_substitute_udf_storage_args: [ OK ] 0.32 sec.
2025-06-25 16:23:36 02483_check_virtuals_shile_using_structure_from_insertion_table: [ OK ] 0.32 sec.
2025-06-25 16:23:38 02483_capnp_decimals: [ OK ] 1.22 sec.
2025-06-25 16:23:38 02482_new_json_nested_arrays_with_same_keys: [ OK ] 0.62 sec.
2025-06-25 16:23:39 02482_json_nested_arrays_with_same_keys: [ OK ] 0.67 sec.
2025-06-25 16:23:40 02481_custom_separated_and_template_with_csv_field: [ OK ] 1.12 sec.
2025-06-25 16:23:42 02459_glob_for_recursive_directory_traversal: [ OK ] 1.42 sec.
2025-06-25 16:23:42 02458_hdfs_cluster_schema_inference: [ OK ] 0.32 sec.
2025-06-25 16:23:45 02440_mutations_finalization: [ OK ] 3.33 sec.
2025-06-25 16:23:46 02422_msgpack_uuid_wrong_column: [ OK ] 0.27 sec.
2025-06-25 16:23:48 02422_allow_implicit_no_password: [ OK ] 2.22 sec.
2025-06-25 16:23:54 02421_record_errors_row_by_input_format: [ OK ] 6.09 sec.
2025-06-25 16:23:54 02411_merge_tree_zero_max_read_buffer_size: [ OK ] 0.27 sec.
2025-06-25 16:23:55 02404_schema_inference_cache_respect_format_settings: [ OK ] 0.52 sec.
2025-06-25 16:23:55 02397_system_parts_race_condition_drop_rm: [ SKIPPED ] 0.00 sec.
2025-06-25 16:23:55 Reason: disabled
2025-06-25 16:23:55 02396_system_parts_race_condition_rm: [ SKIPPED ] 0.00 sec.
2025-06-25 16:23:55 Reason: disabled
2025-06-25 16:23:55 02391_recursive_buffer: [ OK ] 0.37 sec.
2025-06-25 16:23:55 02385_profile_events_overflow: [ OK ] 0.32 sec.
2025-06-25 16:23:56 02376_arrow_dict_with_string: [ OK ] 0.27 sec.
2025-06-25 16:23:57 02373_heap_buffer_overflow_in_avro: [ OK ] 0.87 sec.
2025-06-25 16:23:57 02352_rwlock: [ SKIPPED ] 0.00 sec.
2025-06-25 16:23:57 Reason: not running for current build
2025-06-25 16:23:57 02350_views_max_insert_threads: [ OK ] 0.62 sec.
2025-06-25 16:23:58 02346_additional_filters_distr: [ OK ] 0.27 sec.
2025-06-25 16:23:59 02337_drop_filesystem_cache_access: [ OK ] 1.32 sec.
2025-06-25 16:23:59 02323_null_modifier_in_table_function: [ OK ] 0.27 sec.
2025-06-25 16:24:00 02313_avro_records_and_maps: [ OK ] 0.37 sec.
2025-06-25 16:24:00 02311_system_zookeeper_insert_priv: [ OK ] 0.77 sec.
2025-06-25 16:24:01 02304_orc_arrow_parquet_string_as_string: [ OK ] 0.27 sec.
2025-06-25 16:24:12 02294_overcommit_overflow: [ OK ] 11.35 sec.
2025-06-25 16:24:31 02286_mysql_dump_input_format: [ OK ] 18.87 sec.
2025-06-25 16:24:33 02262_column_ttl: [ OK ] 1.62 sec.
2025-06-25 16:24:43 02247_written_bytes_quota: [ OK ] 10.90 sec.
2025-06-25 16:24:44 02244_lowcardinality_hash_join: [ OK ] 0.32 sec.
127.0.0.1 - - [25/Jun/2025:14:24:47 +0000] "PUT /devstoreaccount1/cont/tiibuxeyxryfdwhebaqgoyaiqzkbqokl HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:24:47 +0000] "PUT /devstoreaccount1/cont/nznkafrmqyylfelpmspvjqmhaphostue HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:24:47 +0000] "PUT /devstoreaccount1/cont/mouffwttgucdgsbjwanijuwjtbzpgwmi HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:24:47 +0000] "PUT /devstoreaccount1/cont/fpujmxtquvgyzqsjwwfjqswtsqwqmlya HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:24:47 +0000] "PUT /devstoreaccount1/cont/qkxsvknsuxmjnyjgvyvyjhvjqrlljuzj HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:24:47 +0000] "PUT /devstoreaccount1/cont/veadvadhgpcytpjcmhakkohjyhahhzfe HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:24:47 +0000] "PUT /devstoreaccount1/cont/pidafdcpfzhtqeremwhlvyaolgxypifi HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:24:47 +0000] "PUT /devstoreaccount1/cont/axrferxnscxhkhwhebqlzyqfytnnnpsi HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:24:47 +0000] "PUT /devstoreaccount1/cont/badvyiwgidsvupswbzuwgoefnjawkuhd HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:24:47 +0000] "PUT /devstoreaccount1/cont/cxnqialokqdwnhmlqdxwgfecsjjnduag HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:24:47 +0000] "GET /devstoreaccount1/cont/mouffwttgucdgsbjwanijuwjtbzpgwmi HTTP/1.1" 206 520
127.0.0.1 - - [25/Jun/2025:14:24:47 +0000] "GET /devstoreaccount1/cont/nznkafrmqyylfelpmspvjqmhaphostue HTTP/1.1" 206 808111
127.0.0.1 - - [25/Jun/2025:14:24:48 +0000] "DELETE /devstoreaccount1/cont/cxnqialokqdwnhmlqdxwgfecsjjnduag HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:24:48 +0000] "DELETE /devstoreaccount1/cont/pidafdcpfzhtqeremwhlvyaolgxypifi HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:24:48 +0000] "DELETE /devstoreaccount1/cont/qkxsvknsuxmjnyjgvyvyjhvjqrlljuzj HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:24:48 +0000] "DELETE /devstoreaccount1/cont/nznkafrmqyylfelpmspvjqmhaphostue HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:24:48 +0000] "DELETE /devstoreaccount1/cont/mouffwttgucdgsbjwanijuwjtbzpgwmi HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:24:48 +0000] "DELETE /devstoreaccount1/cont/fpujmxtquvgyzqsjwwfjqswtsqwqmlya HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:24:48 +0000] "DELETE /devstoreaccount1/cont/veadvadhgpcytpjcmhakkohjyhahhzfe HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:24:48 +0000] "DELETE /devstoreaccount1/cont/badvyiwgidsvupswbzuwgoefnjawkuhd HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:24:48 +0000] "DELETE /devstoreaccount1/cont/axrferxnscxhkhwhebqlzyqfytnnnpsi HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:24:48 +0000] "DELETE /devstoreaccount1/cont/tiibuxeyxryfdwhebaqgoyaiqzkbqokl HTTP/1.1" 202 -
2025-06-25 16:24:48 02242_system_filesystem_cache_log_table: [ OK ] 4.53 sec.
2025-06-25 16:24:59 02242_delete_user_race: [ OK ] 11.10 sec.
127.0.0.1 - - [25/Jun/2025:14:25:10 +0000] "PUT /devstoreaccount1/cont/etvvhiwaxfvgfwyxgnnbpjfpgljjlfda HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:11 +0000] "PUT /devstoreaccount1/cont/ntpxtzvpcuedgocgbbijlcyshvrnzuqr HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:11 +0000] "PUT /devstoreaccount1/cont/fehkhmovhxccryndeohnptclamacqtny HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:11 +0000] "PUT /devstoreaccount1/cont/pfdurymnuigxxjpafbcyfgyxawmrzpmq HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:11 +0000] "PUT /devstoreaccount1/cont/dvorvzxeuijsryeigmsrmgfslabyumlp HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:11 +0000] "PUT /devstoreaccount1/cont/azidcehtfdwnzjzmhyrokvclovgdurpo HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:11 +0000] "PUT /devstoreaccount1/cont/csvurbaduggyglakonuhnwtzkzkuzwpo HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:11 +0000] "PUT /devstoreaccount1/cont/cveoafvzynjdxhzwfqkchvdyhgzvnqvo HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:11 +0000] "PUT /devstoreaccount1/cont/cmonndlaaudjauaymeoheeqpyxuismsf HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:12 +0000] "PUT /devstoreaccount1/cont/ijhonucgvnyfixhizikpipfwxvpmozqc HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:12 +0000] "PUT /devstoreaccount1/cont/udtqpelwpswrazulmiaqjpyrgvjvxjrj HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:12 +0000] "PUT /devstoreaccount1/cont/yaaulvddyyrwetcjuvyvuaxjeemlmkbl HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:12 +0000] "PUT /devstoreaccount1/cont/pdsvxtefiwwxxunxwrpnilgfjlswacrx HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:12 +0000] "PUT /devstoreaccount1/cont/wjdverlfiycsjgeftpyajxrcyhoxbbsr HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:12 +0000] "PUT /devstoreaccount1/cont/oxzmzvjwqrvlmzjjiffwvwhsduqyskgl HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:12 +0000] "PUT /devstoreaccount1/cont/syyvvovcluuegejbsnrlctnxrmcvvsrr HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:12 +0000] "PUT /devstoreaccount1/cont/nfsaqdixltapuyjozyqfxrfgeuthjbhd HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:13 +0000] "PUT /devstoreaccount1/cont/nmgyxypcabzuisscsrjmquemolzdsaej HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:13 +0000] "PUT /devstoreaccount1/cont/fqetvrarcaiuyzgxzggkbixliwyezsgb HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:13 +0000] "PUT /devstoreaccount1/cont/nnzoxojwnvvjiutpjreciydnxupxcsjr HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:13 +0000] "PUT /devstoreaccount1/cont/pawunmywsottjsephanrfyxsegrfbtbc HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:13 +0000] "PUT /devstoreaccount1/cont/ovexapacoefsljgwhfxwadcvcrqttuve HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:13 +0000] "PUT /devstoreaccount1/cont/avxdgrlbojuhbrjjxfifrgeafzkhvyqk HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:13 +0000] "PUT /devstoreaccount1/cont/tswubzeywjajzavvghzjuivivhojvvkb HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:13 +0000] "PUT /devstoreaccount1/cont/gvfhzhhlpaxiobwripqhfiaqqkqzxicq HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:13 +0000] "PUT /devstoreaccount1/cont/poatzyqwuvrlikakuyhygfpebtddbmmu HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:13 +0000] "PUT /devstoreaccount1/cont/mneyfobfczjdgnfthcpsvxmfnjuqehsk HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:13 +0000] "PUT /devstoreaccount1/cont/pdorxifiozjivmcfrqsgfacjqhgzmiya HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:13 +0000] "PUT /devstoreaccount1/cont/ormdcobwhouimrmseffwqvlkhstofaki HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:13 +0000] "PUT /devstoreaccount1/cont/kklibqcnedffermiawyyakyjaocpdlrm HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:13 +0000] "PUT /devstoreaccount1/cont/zltkqoflfelwcunrfngkpvvlxwfyeygd HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:13 +0000] "PUT /devstoreaccount1/cont/qqqxaootpkbfcolchdujkicrjsmajrrh HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:13 +0000] "PUT /devstoreaccount1/cont/tuxulglvvbzxpxpyzobcwzrqaffroowv HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:13 +0000] "PUT /devstoreaccount1/cont/lbyncfotxovvmpbjsfobogryqhdeqhrw HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:13 +0000] "PUT /devstoreaccount1/cont/zvcezyyfagijrecnndeuvsecjicgjkoy HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:13 +0000] "PUT /devstoreaccount1/cont/xtogoeikdtukamaydbnnvurrlyvxhqss HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:13 +0000] "PUT /devstoreaccount1/cont/fvedyaezynzsznafpyxbbenuenkfuuxf HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:13 +0000] "PUT /devstoreaccount1/cont/pjubbywojghacchupdywkdjxoptawdcg HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:13 +0000] "PUT /devstoreaccount1/cont/qydortizaarlmnfvrxfwhtocjcijeuuy HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:13 +0000] "PUT /devstoreaccount1/cont/hsyzydoghwftvkqqxpdmsjjmcwsylolp HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:13 +0000] "PUT /devstoreaccount1/cont/rslqeggqrrltkokrioamshejqzpvbpbw HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "GET /devstoreaccount1/cont/fqetvrarcaiuyzgxzggkbixliwyezsgb HTTP/1.1" 206 80
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "GET /devstoreaccount1/cont/ntpxtzvpcuedgocgbbijlcyshvrnzuqr HTTP/1.1" 206 746
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "GET /devstoreaccount1/cont/nmgyxypcabzuisscsrjmquemolzdsaej HTTP/1.1" 206 746
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/mkquajhouzhapaqoxtckthieuocnwbbd HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/zjeewftrfwongnmagvgmfgiqsiwotttw HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/dwyqgabavnjjwdhfrvrdodehngzyxvlh HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/cxvoxnerhpbjqgauwfpptwpnafvhozfp HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/daiymsbqinqjarnkdafldlefnjcrisqr HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/ksyqjwmjkkdiuwlwtzhdzmvfgzgqmybi HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/gmpscndlulghalcflhxgrjoewnhvotyb HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/vyyozbtsynxdlayuhfbpatdhnveqcyym HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/rcjsyuetrvkkzhtepyosqfcrqcrwuzbj HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/euqrgvditmcjtyngoytxcmzniewlipnr HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/qdmyojvgdxzeggtnmpurmchpmeyqwlns HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/ltpgxodyvozifapvqsbdsijcniavdyts HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/aooqxwgxlilfukooozxsooohgkwezumd HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/mtdvebbvcdyhrvnzdgindrxkfynrjrxp HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/adsftcbkvgjacstczxztlmbvexjagcyf HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/ykggubxfhpbtpqvvcwhknpgqaegnbhuu HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/ltmimxbutqhnnmvucqqqghpuvddtqaut HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/wjyacrpdaxmcsiilzkogxvgaypqtzkmf HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/dxhgrikjmegyzjxonvhomdteularalta HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/tyhylshtvrrwttvqsirinresrdahhvfn HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/kptlziwxjwhvkawdgikygkyrkzabibop HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/yesqldpotgvncwgezicsogmcrsqjxjzt HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/hadfyzlkhfnjeejjczdlrjzjxfrucumy HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/oozqjxgzzmnhzziouttyafitopdthdpf HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/tzgobnowmtqoqqdqdxrmmjmsrjzhjlob HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/pankxhyxbacenyzvyipvozunguutictc HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/fbhwrfxbhhqxycskancmeoeodovrabqd HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/qdykkhhizuhgxkkgvwikymzkbevhkdqh HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/qsyndpkfdbqywlnznceizlfxogjpkhuz HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/mhxanvcmxaueoxedcyrxvagvdyrerlwu HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/fpjdolbeqvtyhhugsmrvhdgiqmlcudhc HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/fpadqdruoweyjiugikxyyxgcjcgabdlu HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/btbhfunogipryaacrymnaogngxswbzxa HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/zmrqdiewbfycksttczhpnagxpcykilsa HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/pgyikurqanaingnwoxqkkuatlgyvtkeq HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/lfjzqwfrgggceukjsqjmckxuhwzzelsw HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:14 +0000] "PUT /devstoreaccount1/cont/asbiomukxswsnmigmdahxbgxrcsjwdps HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/tiolzoijkyqylejhhldkdfdengdcusft HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/arnqewtbrnkyeiaamuohwbsejxvnjtzz HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/donqjsbkqwhailhmmpgtrumusjwazodu HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/yshhwydkxfjyvmoaimsnnznjybsehbyq HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/zovukswvcwhxepiyhcvwvbymdfexlocu HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/xicipictbjgkingkgsmnnbwxgzgpxhas HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/mydhghnnnlgukkiwhuyolyuxmhaxjbxy HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/uffodagoovoqfjzmmqqllyfexoakvyhi HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/xnniqjwummeilfkqeqvfzxwcmpcibcbi HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/sxxrzqsdibzpjdrvvylpksmiitrzvwuc HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/dbbjjcjwqraaqhmbecmlcctjsvqkyexg HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/bevihzyuvomndchkvadaelpuaqwfpduk HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/rdcuvvzrbqbowhblxweicisaryakrgmu HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/fdlvdaqbepjouljgkqbtbsgarwcjzjoy HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/ocxlrjhyjgkylxxhcwfrsjgrttdntpzq HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/cmugkekdvtbnibpbqmjoxxhyjgnrqfpd HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/klzxigeozwiulgphwiurchoivyizqevq HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/gmkpdilxksmkfonosrrulghejxtnlhjy HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/axoexkeksqjyicdiesocjismlxdccuxa HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/lpayzuforkklvhmcmdiojbhbwclvazhq HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/tbiwxvdefmwgcjwhvcetsidgvltfpidr HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/oafuuodyobfdohihsfszhejepgoyryks HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/efchzmppwgunrcvvueszpcjwocnycjig HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/wkdbahnmitsjfacvormbnjfmhfbszkme HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/kqspvvgbtjcdjhwptppgbpyzwoflzcpk HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/rioleyzdmjyicuoerylydgkpbhrflgan HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/wbodzbpcxgwlyolwtqkabvqgziguwxqb HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/hmaqfhjljiitktyoshqotdqjvmkvkhpm HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/rnmiwhdagxdhneyvkmolhunttewnevto HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:15 +0000] "PUT /devstoreaccount1/cont/ueqjhhregjqtvdkfzicttbafjeuccdzf HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "PUT /devstoreaccount1/cont/iogccohqiwyhbpdmlavefowughaqgcka HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "PUT /devstoreaccount1/cont/mshvcxujlmcumzrbniniyrnwbwlmpeiv HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "PUT /devstoreaccount1/cont/pxkneocfafmgxndqmbhsxcdljoejhadm HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "PUT /devstoreaccount1/cont/faasyafzfzdmhfhpohcejzrcbyaihzjl HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "PUT /devstoreaccount1/cont/cedcsjikqahnrmvppseqjblgsggslfzx HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "PUT /devstoreaccount1/cont/ebxqmmfqdpmponrhroujgldqgkzragya HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "PUT /devstoreaccount1/cont/xvefstomlwdielilmayiytqoomecmtiu HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "PUT /devstoreaccount1/cont/wmlrknfdalkymlbozsjgvnfdonsbvkvi HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "PUT /devstoreaccount1/cont/ejnzwpxkycwadfnlymownpmxlbsvfysp HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "PUT /devstoreaccount1/cont/dwmbjvzgqsbhodcxefvbteajlkgviuei HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/dwmbjvzgqsbhodcxefvbteajlkgviuei HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/iogccohqiwyhbpdmlavefowughaqgcka HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/ebxqmmfqdpmponrhroujgldqgkzragya HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/mshvcxujlmcumzrbniniyrnwbwlmpeiv HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/xvefstomlwdielilmayiytqoomecmtiu HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/cedcsjikqahnrmvppseqjblgsggslfzx HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/pxkneocfafmgxndqmbhsxcdljoejhadm HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/faasyafzfzdmhfhpohcejzrcbyaihzjl HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/ejnzwpxkycwadfnlymownpmxlbsvfysp HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/wmlrknfdalkymlbozsjgvnfdonsbvkvi HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/cmonndlaaudjauaymeoheeqpyxuismsf HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/azidcehtfdwnzjzmhyrokvclovgdurpo HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/dvorvzxeuijsryeigmsrmgfslabyumlp HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/ntpxtzvpcuedgocgbbijlcyshvrnzuqr HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/fehkhmovhxccryndeohnptclamacqtny HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/pfdurymnuigxxjpafbcyfgyxawmrzpmq HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/cveoafvzynjdxhzwfqkchvdyhgzvnqvo HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/csvurbaduggyglakonuhnwtzkzkuzwpo HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/vyyozbtsynxdlayuhfbpatdhnveqcyym HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/daiymsbqinqjarnkdafldlefnjcrisqr HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/cxvoxnerhpbjqgauwfpptwpnafvhozfp HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/mkquajhouzhapaqoxtckthieuocnwbbd HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/zjeewftrfwongnmagvgmfgiqsiwotttw HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/dwyqgabavnjjwdhfrvrdodehngzyxvlh HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/gmpscndlulghalcflhxgrjoewnhvotyb HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/ksyqjwmjkkdiuwlwtzhdzmvfgzgqmybi HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/ltmimxbutqhnnmvucqqqghpuvddtqaut HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/mtdvebbvcdyhrvnzdgindrxkfynrjrxp HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/aooqxwgxlilfukooozxsooohgkwezumd HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/euqrgvditmcjtyngoytxcmzniewlipnr HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/qdmyojvgdxzeggtnmpurmchpmeyqwlns HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/ltpgxodyvozifapvqsbdsijcniavdyts HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/ykggubxfhpbtpqvvcwhknpgqaegnbhuu HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/adsftcbkvgjacstczxztlmbvexjagcyf HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/nfsaqdixltapuyjozyqfxrfgeuthjbhd HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/wjdverlfiycsjgeftpyajxrcyhoxbbsr HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/pdsvxtefiwwxxunxwrpnilgfjlswacrx HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/ijhonucgvnyfixhizikpipfwxvpmozqc HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/udtqpelwpswrazulmiaqjpyrgvjvxjrj HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/yaaulvddyyrwetcjuvyvuaxjeemlmkbl HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/syyvvovcluuegejbsnrlctnxrmcvvsrr HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/oxzmzvjwqrvlmzjjiffwvwhsduqyskgl HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/gvfhzhhlpaxiobwripqhfiaqqkqzxicq HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/ovexapacoefsljgwhfxwadcvcrqttuve HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/pawunmywsottjsephanrfyxsegrfbtbc HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/nmgyxypcabzuisscsrjmquemolzdsaej HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/fqetvrarcaiuyzgxzggkbixliwyezsgb HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/nnzoxojwnvvjiutpjreciydnxupxcsjr HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/tswubzeywjajzavvghzjuivivhojvvkb HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/avxdgrlbojuhbrjjxfifrgeafzkhvyqk HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/tuxulglvvbzxpxpyzobcwzrqaffroowv HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/kklibqcnedffermiawyyakyjaocpdlrm HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/ormdcobwhouimrmseffwqvlkhstofaki HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/poatzyqwuvrlikakuyhygfpebtddbmmu HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/mneyfobfczjdgnfthcpsvxmfnjuqehsk HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/pdorxifiozjivmcfrqsgfacjqhgzmiya HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/qqqxaootpkbfcolchdujkicrjsmajrrh HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/zltkqoflfelwcunrfngkpvvlxwfyeygd HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/rslqeggqrrltkokrioamshejqzpvbpbw HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/pjubbywojghacchupdywkdjxoptawdcg HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/fvedyaezynzsznafpyxbbenuenkfuuxf HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/lbyncfotxovvmpbjsfobogryqhdeqhrw HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/zvcezyyfagijrecnndeuvsecjicgjkoy HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/xtogoeikdtukamaydbnnvurrlyvxhqss HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/hsyzydoghwftvkqqxpdmsjjmcwsylolp HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/qydortizaarlmnfvrxfwhtocjcijeuuy HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/fbhwrfxbhhqxycskancmeoeodovrabqd HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/wjyacrpdaxmcsiilzkogxvgaypqtzkmf HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/hadfyzlkhfnjeejjczdlrjzjxfrucumy HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/dxhgrikjmegyzjxonvhomdteularalta HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/oozqjxgzzmnhzziouttyafitopdthdpf HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/yesqldpotgvncwgezicsogmcrsqjxjzt HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/tyhylshtvrrwttvqsirinresrdahhvfn HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/kptlziwxjwhvkawdgikygkyrkzabibop HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/pankxhyxbacenyzvyipvozunguutictc HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/tzgobnowmtqoqqdqdxrmmjmsrjzhjlob HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/asbiomukxswsnmigmdahxbgxrcsjwdps HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/qdykkhhizuhgxkkgvwikymzkbevhkdqh HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/btbhfunogipryaacrymnaogngxswbzxa HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/qsyndpkfdbqywlnznceizlfxogjpkhuz HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/zmrqdiewbfycksttczhpnagxpcykilsa HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/fpadqdruoweyjiugikxyyxgcjcgabdlu HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/mhxanvcmxaueoxedcyrxvagvdyrerlwu HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/fpjdolbeqvtyhhugsmrvhdgiqmlcudhc HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/lfjzqwfrgggceukjsqjmckxuhwzzelsw HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/pgyikurqanaingnwoxqkkuatlgyvtkeq HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/sxxrzqsdibzpjdrvvylpksmiitrzvwuc HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/tiolzoijkyqylejhhldkdfdengdcusft HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/xicipictbjgkingkgsmnnbwxgzgpxhas HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/arnqewtbrnkyeiaamuohwbsejxvnjtzz HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/mydhghnnnlgukkiwhuyolyuxmhaxjbxy HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/zovukswvcwhxepiyhcvwvbymdfexlocu HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/donqjsbkqwhailhmmpgtrumusjwazodu HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/yshhwydkxfjyvmoaimsnnznjybsehbyq HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/xnniqjwummeilfkqeqvfzxwcmpcibcbi HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/uffodagoovoqfjzmmqqllyfexoakvyhi HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/lpayzuforkklvhmcmdiojbhbwclvazhq HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/dbbjjcjwqraaqhmbecmlcctjsvqkyexg HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/cmugkekdvtbnibpbqmjoxxhyjgnrqfpd HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/bevihzyuvomndchkvadaelpuaqwfpduk HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/klzxigeozwiulgphwiurchoivyizqevq HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/ocxlrjhyjgkylxxhcwfrsjgrttdntpzq HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/rdcuvvzrbqbowhblxweicisaryakrgmu HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/fdlvdaqbepjouljgkqbtbsgarwcjzjoy HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/axoexkeksqjyicdiesocjismlxdccuxa HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/gmkpdilxksmkfonosrrulghejxtnlhjy HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/ueqjhhregjqtvdkfzicttbafjeuccdzf HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/tbiwxvdefmwgcjwhvcetsidgvltfpidr HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/rioleyzdmjyicuoerylydgkpbhrflgan HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/oafuuodyobfdohihsfszhejepgoyryks HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/wbodzbpcxgwlyolwtqkabvqgziguwxqb HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/kqspvvgbtjcdjhwptppgbpyzwoflzcpk HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/efchzmppwgunrcvvueszpcjwocnycjig HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/wkdbahnmitsjfacvormbnjfmhfbszkme HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/rnmiwhdagxdhneyvkmolhunttewnevto HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/hmaqfhjljiitktyoshqotdqjvmkvkhpm HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/etvvhiwaxfvgfwyxgnnbpjfpgljjlfda HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:16 +0000] "DELETE /devstoreaccount1/cont/rcjsyuetrvkkzhtepyosqfcrqcrwuzbj HTTP/1.1" 202 -
2025-06-25 16:25:16 02241_filesystem_cache_on_write_operations: [ OK ] 16.11 sec.
2025-06-25 16:25:16 02240_filesystem_cache_bypass_cache_threshold: [ OK ] 0.27 sec.
2025-06-25 16:25:17 02240_filesystem_query_cache: [ OK ] 0.32 sec.
127.0.0.1 - - [25/Jun/2025:14:25:21 +0000] "PUT /devstoreaccount1/cont/mtontbbubmodeposbewdeneogaowjjnt HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:22 +0000] "PUT /devstoreaccount1/cont/ifyldmhrkskbkajvnhpmbljtjwfolstu HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:22 +0000] "PUT /devstoreaccount1/cont/dftsjxmqmcqzovrbuhzaieekxvjrxxtc HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:22 +0000] "PUT /devstoreaccount1/cont/njutpxdctcatgexznukmprlhienfskqp HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:22 +0000] "PUT /devstoreaccount1/cont/bdaihmmfgzbpaaespzpsznlwzdztyqpw HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:22 +0000] "PUT /devstoreaccount1/cont/ioyoedwasycnzkwzjiwtrlzccspenjza HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:22 +0000] "PUT /devstoreaccount1/cont/cisexhzphgndwjsntjdjrslfuwlshjjs HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:22 +0000] "PUT /devstoreaccount1/cont/icefgfrjbvimrkkqalhpkhonfhowgcpi HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:22 +0000] "PUT /devstoreaccount1/cont/dmghnuauuvqewyhjshovwoetiixwwcvr HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:22 +0000] "PUT /devstoreaccount1/cont/uivnyvdkhyansguhghskidhkktyqfmzb HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:22 +0000] "GET /devstoreaccount1/cont/dftsjxmqmcqzovrbuhzaieekxvjrxxtc HTTP/1.1" 206 80
127.0.0.1 - - [25/Jun/2025:14:25:22 +0000] "GET /devstoreaccount1/cont/ifyldmhrkskbkajvnhpmbljtjwfolstu HTTP/1.1" 206 746
127.0.0.1 - - [25/Jun/2025:14:25:23 +0000] "GET /devstoreaccount1/cont/dftsjxmqmcqzovrbuhzaieekxvjrxxtc HTTP/1.1" 206 80
127.0.0.1 - - [25/Jun/2025:14:25:23 +0000] "GET /devstoreaccount1/cont/ifyldmhrkskbkajvnhpmbljtjwfolstu HTTP/1.1" 206 746
127.0.0.1 - - [25/Jun/2025:14:25:23 +0000] "DELETE /devstoreaccount1/cont/uivnyvdkhyansguhghskidhkktyqfmzb HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:23 +0000] "DELETE /devstoreaccount1/cont/cisexhzphgndwjsntjdjrslfuwlshjjs HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:23 +0000] "DELETE /devstoreaccount1/cont/bdaihmmfgzbpaaespzpsznlwzdztyqpw HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:23 +0000] "DELETE /devstoreaccount1/cont/ifyldmhrkskbkajvnhpmbljtjwfolstu HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:23 +0000] "DELETE /devstoreaccount1/cont/dftsjxmqmcqzovrbuhzaieekxvjrxxtc HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:23 +0000] "DELETE /devstoreaccount1/cont/njutpxdctcatgexznukmprlhienfskqp HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:23 +0000] "DELETE /devstoreaccount1/cont/ioyoedwasycnzkwzjiwtrlzccspenjza HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:23 +0000] "DELETE /devstoreaccount1/cont/dmghnuauuvqewyhjshovwoetiixwwcvr HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:23 +0000] "DELETE /devstoreaccount1/cont/icefgfrjbvimrkkqalhpkhonfhowgcpi HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:23 +0000] "DELETE /devstoreaccount1/cont/mtontbbubmodeposbewdeneogaowjjnt HTTP/1.1" 202 -
2025-06-25 16:25:23 02240_system_filesystem_cache_table: [ OK ] 6.54 sec.
2025-06-25 16:25:23 02232_dist_insert_send_logs_level_hung: [ SKIPPED ] 0.00 sec.
2025-06-25 16:25:23 Reason: disabled
2025-06-25 16:25:24 02227_test_create_empty_sqlite_db: [ OK ] 1.12 sec.
127.0.0.1 - - [25/Jun/2025:14:25:28 +0000] "PUT /devstoreaccount1/cont/qagkclbvxggcxtgpildolvadnceoxbof HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:28 +0000] "PUT /devstoreaccount1/cont/xzcwrkdaytevevgocnnhukxkzmgvqavl HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:28 +0000] "PUT /devstoreaccount1/cont/tgrvvkzpjglzxrzjjaytkgksoqcobqbv HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:28 +0000] "PUT /devstoreaccount1/cont/wlcgoakkxaciizaxwislmevjulojfzcs HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:28 +0000] "PUT /devstoreaccount1/cont/cfwyqufopufxenfucvahbxuzymzcaaha HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:28 +0000] "PUT /devstoreaccount1/cont/mflrjevrrzolygsqcfuasftzgptidfte HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:28 +0000] "PUT /devstoreaccount1/cont/gvklvzoldxcefkuxyakucefmqqajzioq HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:28 +0000] "PUT /devstoreaccount1/cont/ygmhznebgahxajepetqqedjrtbxfvyru HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:28 +0000] "PUT /devstoreaccount1/cont/haupdwyrokyygubgysywhfhnbkuqbavr HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:28 +0000] "PUT /devstoreaccount1/cont/qohipazvbsqayttykcwjceeshgfzmoqx HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:28 +0000] "GET /devstoreaccount1/cont/tgrvvkzpjglzxrzjjaytkgksoqcobqbv HTTP/1.1" 206 62
127.0.0.1 - - [25/Jun/2025:14:25:28 +0000] "GET /devstoreaccount1/cont/xzcwrkdaytevevgocnnhukxkzmgvqavl HTTP/1.1" 206 100555
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "PUT /devstoreaccount1/cont/bslpslfzspbcjnqocmkcyxoytpoibhyg HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "PUT /devstoreaccount1/cont/irbrqmeoqcxaqtspskcvdfidrxtmlhxi HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "PUT /devstoreaccount1/cont/wyuidnfgmubxdrcjlxixlpmsekhfmviq HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "PUT /devstoreaccount1/cont/mvewglhjwlkofsgsgxdvojvuaftqvkvx HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "PUT /devstoreaccount1/cont/vmkfrumjrclsaugbrtbowcmwpzttujux HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "DELETE /devstoreaccount1/cont/qohipazvbsqayttykcwjceeshgfzmoqx HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "DELETE /devstoreaccount1/cont/gvklvzoldxcefkuxyakucefmqqajzioq HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "DELETE /devstoreaccount1/cont/cfwyqufopufxenfucvahbxuzymzcaaha HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "DELETE /devstoreaccount1/cont/tgrvvkzpjglzxrzjjaytkgksoqcobqbv HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "DELETE /devstoreaccount1/cont/xzcwrkdaytevevgocnnhukxkzmgvqavl HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "DELETE /devstoreaccount1/cont/wlcgoakkxaciizaxwislmevjulojfzcs HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "DELETE /devstoreaccount1/cont/mflrjevrrzolygsqcfuasftzgptidfte HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "DELETE /devstoreaccount1/cont/haupdwyrokyygubgysywhfhnbkuqbavr HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "DELETE /devstoreaccount1/cont/ygmhznebgahxajepetqqedjrtbxfvyru HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "PUT /devstoreaccount1/cont/aqjgfixbdswzkscnxjbyvttogivppujq HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "PUT /devstoreaccount1/cont/aswwwlhyxoulpjyruficszyrasiozjhi HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "PUT /devstoreaccount1/cont/xzqrqspdvpragwuawwwhdhntornkkker HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "PUT /devstoreaccount1/cont/wznhpotiikjqwkxoigibstjpdsacvyat HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "PUT /devstoreaccount1/cont/xldhfxeohlmmspsbpbztlpqyuzlqkzwd HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "PUT /devstoreaccount1/cont/ncrtlzlluunwnemdrebysmgvcochjrtb HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "PUT /devstoreaccount1/cont/kfhdoobfldpueqwfkmcbvhypntaqhdep HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "PUT /devstoreaccount1/cont/psgeleqirraleyebkzbkgpmxmzkcxrnz HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "PUT /devstoreaccount1/cont/cxuvoqneiuoparmasloculafvymfhjny HTTP/1.1" 201 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "DELETE /devstoreaccount1/cont/vmkfrumjrclsaugbrtbowcmwpzttujux HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "DELETE /devstoreaccount1/cont/irbrqmeoqcxaqtspskcvdfidrxtmlhxi HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "DELETE /devstoreaccount1/cont/bslpslfzspbcjnqocmkcyxoytpoibhyg HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "DELETE /devstoreaccount1/cont/pbiaxmgqeqtxwcgazgtgxnsirevokezb HTTP/1.1" 404 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "DELETE /devstoreaccount1/cont/gpxwkagloubxdwsiwlnypviqbahsdukf HTTP/1.1" 404 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "DELETE /devstoreaccount1/cont/hamixgrajkxonhnaehexfwacvgdazadu HTTP/1.1" 404 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "DELETE /devstoreaccount1/cont/mvewglhjwlkofsgsgxdvojvuaftqvkvx HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "DELETE /devstoreaccount1/cont/wyuidnfgmubxdrcjlxixlpmsekhfmviq HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "DELETE /devstoreaccount1/cont/cxuvoqneiuoparmasloculafvymfhjny HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "DELETE /devstoreaccount1/cont/ncrtlzlluunwnemdrebysmgvcochjrtb HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "DELETE /devstoreaccount1/cont/wznhpotiikjqwkxoigibstjpdsacvyat HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "DELETE /devstoreaccount1/cont/aswwwlhyxoulpjyruficszyrasiozjhi HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "DELETE /devstoreaccount1/cont/aqjgfixbdswzkscnxjbyvttogivppujq HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "DELETE /devstoreaccount1/cont/xzqrqspdvpragwuawwwhdhntornkkker HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "DELETE /devstoreaccount1/cont/xldhfxeohlmmspsbpbztlpqyuzlqkzwd HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "DELETE /devstoreaccount1/cont/psgeleqirraleyebkzbkgpmxmzkcxrnz HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "DELETE /devstoreaccount1/cont/kfhdoobfldpueqwfkmcbvhypntaqhdep HTTP/1.1" 202 -
127.0.0.1 - - [25/Jun/2025:14:25:29 +0000] "DELETE /devstoreaccount1/cont/qagkclbvxggcxtgpildolvadnceoxbof HTTP/1.1" 202 -
2025-06-25 16:25:29 02226_filesystem_cache_profile_events: [ OK ] 4.93 sec.
2025-06-25 16:25:30 02225_unwinder_dwarf_version: [ OK ] 0.77 sec.
2025-06-25 16:25:33 02222_create_table_without_columns_metadata: [ OK ] 2.83 sec.
2025-06-25 16:25:35 02207_allow_plaintext_and_no_password: [ OK ] 2.33 sec.
2025-06-25 16:25:37 02185_values_schema_inference: [ OK ] 1.62 sec.
2025-06-25 16:25:38 02184_ipv6_parsing: [ OK ] 0.97 sec.
2025-06-25 16:25:39 02182_json_each_row_schema_inference: [ OK ] 0.87 sec.
2025-06-25 16:25:39 02179_dict_reload_on_cluster: [ OK ] 0.47 sec.
2025-06-25 16:25:40 02177_temporary_table_current_database_http_session: [ OK ] 0.62 sec.
2025-06-25 16:25:40 02168_avro_bug: [ OK ] 0.27 sec.
2025-06-25 16:25:41 02166_arrow_dictionary_inference: [ OK ] 0.97 sec.
2025-06-25 16:25:42 02155_multiple_inserts_for_formats_with_suffix: [ OK ] 0.42 sec.
2025-06-25 16:25:42 02148_sql_user_defined_function_subquery: [ OK ] 0.37 sec.
2025-06-25 16:25:42 02126_identity_user_defined_function: [ OK ] 0.32 sec.
2025-06-25 16:25:43 02125_recursive_sql_user_defined_functions: [ OK ] 0.37 sec.
2025-06-25 16:25:43 02125_many_mutations_2: [ SKIPPED ] 0.00 sec.
2025-06-25 16:25:43 Reason: not running for current build
2025-06-25 16:25:44 02105_table_function_file_partiotion_by: [ OK ] 1.37 sec.
2025-06-25 16:25:45 02104_json_strings_nullable_string: [ OK ] 0.92 sec.
2025-06-25 16:25:45 02103_sql_user_defined_functions_composition: [ OK ] 0.27 sec.
2025-06-25 16:25:51 02103_tsv_csv_custom_null_representation: [ OK ] 5.48 sec.
2025-06-25 16:25:51 02101_sql_user_defined_functions_drop_if_exists: [ OK ] 0.27 sec.
2025-06-25 16:25:51 02098_sql_user_defined_functions_aliases: [ OK ] 0.27 sec.
2025-06-25 16:25:52 02096_sql_user_defined_function_alias: [ OK ] 0.22 sec.
2025-06-25 16:25:52 02096_rename_atomic_hang: [ OK ] 0.32 sec.
2025-06-25 16:25:54 02051_read_settings: [ OK ] 1.78 sec.
2025-06-25 16:25:54 02028_add_default_database_for_alterquery_on_cluster: [ OK ] 0.72 sec.
2025-06-25 16:26:02 02026_storage_filelog_largefile: [ OK ] 7.49 sec.
2025-06-25 16:26:02 02025_dictionary_view_different_db: [ OK ] 0.37 sec.
2025-06-25 16:26:03 02015_column_default_dict_get_identifier: [ OK ] 0.32 sec.
2025-06-25 16:26:04 02015_global_in_threads: [ OK ] 1.37 sec.
2025-06-25 16:26:04 02011_dictionary_empty_attribute_list: [ OK ] 0.27 sec.
2025-06-25 16:26:05 01999_grant_with_replace: [ OK ] 0.37 sec.
2025-06-25 16:26:05 01948_dictionary_quoted_database_name: [ OK ] 0.32 sec.
2025-06-25 16:26:05 01915_create_or_replace_dictionary: [ OK ] 0.32 sec.
2025-06-25 16:26:06 01913_exact_rows_before_limit_full: [ OK ] 0.37 sec.
2025-06-25 16:26:06 01910_view_dictionary: [ OK ] 0.37 sec.
2025-06-25 16:26:07 01903_ssd_cache_dictionary_array_type: [ OK ] 0.87 sec.
2025-06-25 16:26:08 01902_table_function_merge_db_repr: [ OK ] 0.47 sec.
2025-06-25 16:26:08 01901_test_attach_partition_from: [ OK ] 0.52 sec.
2025-06-25 16:26:09 01889_postgresql_protocol_null_fields: [ OK ] 0.77 sec.
2025-06-25 16:26:09 01870_buffer_flush: [ OK ] 0.27 sec.
2025-06-25 16:26:09 01856_create_function: [ OK ] 0.32 sec.
2025-06-25 16:26:11 01853_dictionary_cache_duplicates: [ OK ] 1.42 sec.
2025-06-25 16:26:11 01850_dist_INSERT_preserve_error: [ OK ] 0.32 sec.
2025-06-25 16:26:12 01837_database_memory_ddl_dictionaries: [ OK ] 0.32 sec.
2025-06-25 16:26:12 01821_table_comment: [ OK ] 0.42 sec.
2025-06-25 16:26:13 01785_dictionary_element_count: [ OK ] 0.47 sec.
2025-06-25 16:26:13 01778_hierarchical_dictionaries: [ OK ] 0.47 sec.
2025-06-25 16:26:14 01754_direct_dictionary_complex_key: [ OK ] 0.72 sec.
2025-06-25 16:26:15 01753_direct_dictionary_simple_key: [ OK ] 0.77 sec.
2025-06-25 16:26:15 01747_executable_pool_dictionary_implicit_key: [ OK ] 0.67 sec.
2025-06-25 16:26:16 01746_executable_pool_dictionary: [ OK ] 0.68 sec.
2025-06-25 16:26:18 01737_clickhouse_server_wait_server_pool_long: [ OK ] 1.77 sec.
2025-06-25 16:26:19 01722_long_brotli_http_compression_json_format: [ OK ] 1.07 sec.
2025-06-25 16:26:19 01721_engine_file_truncate_on_insert: [ OK ] 0.27 sec.
2025-06-25 16:26:22 01710_projection_vertical_merges: [ OK ] 2.72 sec.
2025-06-25 16:26:22 01681_cache_dictionary_simple_key: [ OK ] 0.62 sec.
2025-06-25 16:26:23 01676_dictget_in_default_expression: [ OK ] 0.42 sec.
2025-06-25 16:26:23 01670_dictionary_create_key_expression: [ OK ] 0.37 sec.
2025-06-25 16:26:24 01646_system_restart_replicas_smoke: [ OK ] 0.37 sec.
2025-06-25 16:26:25 01643_replicated_merge_tree_fsync_smoke: [ OK ] 1.28 sec.
2025-06-25 16:26:25 01615_random_one_shard_insertion: [ OK ] 0.47 sec.
2025-06-25 16:26:26 01603_rename_overwrite_bug: [ OK ] 0.47 sec.
2025-06-25 16:26:48 01600_detach_permanently: [ OK ] 21.91 sec.
2025-06-25 16:27:30 01593_concurrent_alter_mutations_kill_many_replicas_long: [ OK ] 42.49 sec.
2025-06-25 16:27:31 01575_disable_detach_table_of_dictionary: [ OK ] 0.27 sec.
2025-06-25 16:27:31 01530_drop_database_atomic_sync: [ OK ] 0.52 sec.
2025-06-25 16:27:32 01527_clickhouse_local_optimize: [ OK ] 0.87 sec.
2025-06-25 16:27:32 01526_complex_key_dict_direct_layout: [ OK ] 0.37 sec.
2025-06-25 16:27:33 01524_do_not_merge_across_partitions_select_final: [ OK ] 0.87 sec.
2025-06-25 16:27:34 01517_drop_mv_with_inner_table: [ OK ] 0.37 sec.
2025-06-25 16:27:36 01507_clickhouse_server_start_with_embedded_config: [ OK ] 2.33 sec.
2025-06-25 16:27:37 01501_cache_dictionary_all_fields: [ OK ] 1.07 sec.
2025-06-25 16:27:39 01474_executable_dictionary: [ OK ] 1.53 sec.
2025-06-25 16:27:39 01471_calculate_ttl_during_merge: [ OK ] 0.42 sec.
2025-06-25 16:27:52 01459_manual_write_to_replicas_quorum_detach_attach: [ OK ] 12.30 sec.
2025-06-25 16:27:52 01459_manual_write_to_replicas: [ SKIPPED ] 0.00 sec.
2025-06-25 16:27:52 Reason: not running for current build
2025-06-25 16:27:52 01457_create_as_table_function_structure: [ OK ] 0.37 sec.
2025-06-25 16:27:52 01455_rank_correlation_spearman: [ OK ] 0.32 sec.
2025-06-25 16:28:13 01454_storagememory_data_race_challenge: [ OK ] 20.63 sec.
2025-06-25 16:28:16 01417_freeze_partition_verbose_zookeeper: [ OK ] 3.18 sec.
2025-06-25 16:28:21 01417_freeze_partition_verbose: [ OK ] 5.34 sec.
2025-06-25 16:29:06 01414_mutations_and_errors_zookeeper: [ OK ] 44.24 sec.
2025-06-25 16:29:08 01410_nullable_key_more_tests: [ OK ] 2.17 sec.
2025-06-25 16:29:11 01375_storage_file_tsv_csv_with_names_write_prefix: [ OK ] 3.38 sec.
2025-06-25 16:29:13 01360_materialized_view_with_join_on_query_log: [ OK ] 1.72 sec.
2025-06-25 16:29:14 01356_view_threads: [ OK ] 0.47 sec.
2025-06-25 16:29:24 01320_create_sync_race_condition_zookeeper: [ OK ] 10.25 sec.
2025-06-25 16:29:28 01307_multiple_leaders_zookeeper: [ OK ] 3.78 sec.
2025-06-25 16:29:38 01305_replica_create_drop_zookeeper: [ OK ] 10.90 sec.
2025-06-25 16:30:10 01301_aggregate_state_exception_memory_leak: [ OK ] 31.26 sec.
2025-06-25 16:30:10 01297_create_quota: [ OK ] 0.67 sec.
2025-06-25 16:30:11 01295_create_row_policy: [ OK ] 0.42 sec.
2025-06-25 16:30:11 01294_system_distributed_on_cluster: [ OK ] 0.42 sec.
2025-06-25 16:30:12 01294_create_settings_profile: [ OK ] 0.47 sec.
2025-06-25 16:30:12 01293_system_distribution_queue: [ OK ] 0.32 sec.
2025-06-25 16:30:13 01281_unsucceeded_insert_select_queries_counter: [ OK ] 0.37 sec.
2025-06-25 16:30:16 01281_group_by_limit_memory_tracking: [ OK ] 3.93 sec.
2025-06-25 16:30:19 01280_ssd_complex_key_dictionary: [ OK ] 2.38 sec.
2025-06-25 16:31:02 01275_parallel_mv: [ OK ] 43.04 sec.
2025-06-25 16:31:02 01251_dict_is_in_infinite_loop: [ OK ] 0.52 sec.
2025-06-25 16:31:03 01225_show_create_table_from_dictionary: [ OK ] 0.27 sec.
2025-06-25 16:31:35 01192_rename_database_zookeeper: [ OK ] 32.01 sec.
2025-06-25 16:31:35 01164_alter_memory_database: [ OK ] 0.32 sec.
2025-06-25 16:31:36 01155_rename_move_materialized_view: [ OK ] 0.62 sec.
2025-06-25 16:32:30 01154_move_partition_long: [ OK ] 54.38 sec.
2025-06-25 16:32:31 01153_attach_mv_uuid: [ OK ] 0.42 sec.
2025-06-25 16:32:31 01148_zookeeper_path_macros_unfolding: [ OK ] 0.77 sec.
2025-06-25 16:32:32 01119_weird_user_names: [ OK ] 0.37 sec.
2025-06-25 16:33:07 01111_create_drop_replicated_db_stress: [ OK ] 35.12 sec.
2025-06-25 16:33:07 01110_dictionary_layout_without_arguments: [ OK ] 0.27 sec.
2025-06-25 16:33:08 01103_distributed_product_mode_local_column_renames: [ OK ] 0.47 sec.
2025-06-25 16:33:15 01098_temporary_and_external_tables: [ OK ] 6.84 sec.
2025-06-25 16:33:15 01091_num_threads: [ OK ] 0.77 sec.
2025-06-25 16:33:17 01085_max_distributed_connections_http: [ OK ] 1.57 sec.
2025-06-25 16:33:50 01083_expressions_in_engine_arguments: [ OK ] 32.66 sec.
2025-06-25 16:33:51 01082_window_view_watch_limit: [ OK ] 0.97 sec.
2025-06-25 16:34:15 01079_parallel_alter_detach_table_zookeeper: [ OK ] 24.14 sec.
2025-06-25 16:34:21 01076_cache_dictionary_datarace_exception_ptr: [ OK ] 6.44 sec.
2025-06-25 16:34:25 01075_window_view_proc_tumble_to_now_populate: [ OK ] 3.98 sec.
2025-06-25 16:34:26 01070_materialize_ttl: [ OK ] 0.67 sec.
2025-06-25 16:34:26 01070_mutations_with_dependencies: [ OK ] 0.52 sec.
2025-06-25 16:34:27 01070_modify_ttl: [ OK ] 0.67 sec.
2025-06-25 16:34:35 01069_window_view_proc_tumble_watch: [ OK ] 8.34 sec.
2025-06-25 16:34:37 01065_window_view_event_hop_watch_bounded: [ OK ] 1.12 sec.
2025-06-25 16:34:37 01060_shutdown_table_after_detach: [ OK ] 0.77 sec.
2025-06-25 16:34:40 01055_window_view_proc_hop_to: [ OK ] 2.88 sec.
2025-06-25 16:34:42 01053_ssd_dictionary: [ OK ] 2.07 sec.
2025-06-25 16:34:48 01038_dictionary_lifetime_min_zero_sec: [ OK ] 5.89 sec.
2025-06-25 16:34:49 01036_no_superfluous_dict_reload_on_create_database: [ OK ] 0.32 sec.
2025-06-25 16:34:49 01036_no_superfluous_dict_reload_on_create_database_2: [ OK ] 0.37 sec.
2025-06-25 16:34:49 01023_materialized_view_query_context: [ OK ] 0.42 sec.
2025-06-25 16:35:01 01018_ddl_dictionaries_concurrent_requrests: [ OK ] 11.59 sec.
2025-06-25 16:35:04 01018_ddl_dictionaries_bad_queries: [ OK ] 2.53 sec.
2025-06-25 16:35:26 01014_lazy_database_concurrent_recreate_reattach_and_show_tables: [ OK ] 22.78 sec.
2025-06-25 16:35:41 01014_lazy_database_basic: [ OK ] 14.96 sec.
2025-06-25 16:35:44 01013_sync_replica_timeout_zookeeper: [ OK ] 2.17 sec.
2025-06-25 16:35:55 01007_r1r2_w_r2r1_deadlock: [ OK ] 11.75 sec.
2025-06-25 16:36:08 01004_rename_deadlock: [ OK ] 12.65 sec.
2025-06-25 16:36:09 00985_merge_stack_overflow: [ OK ] 0.72 sec.
2025-06-25 16:36:09 00971_query_id_in_logs: [ OK ] 0.77 sec.
2025-06-25 16:36:10 00963_achimbab: [ OK ] 0.32 sec.
2025-06-25 16:36:11 00950_dict_get: [ OK ] 0.87 sec.
2025-06-25 16:36:12 00877_memory_limit_for_new_delete: [ OK ] 1.47 sec.
2025-06-25 16:36:12 00840_long_concurrent_select_and_drop_deadlock: [ SKIPPED ] 0.00 sec.
2025-06-25 16:36:12 Reason: not running for current build
2025-06-25 16:36:13 00722_inner_join: [ OK ] 0.42 sec.
2025-06-25 16:36:13 00693_max_block_size_system_tables_columns: [ OK ] 0.47 sec.
2025-06-25 16:36:16 00623_truncate_table_throw_exception: [ OK ] 3.03 sec.
2025-06-25 16:36:17 00510_materizlized_view_and_deduplication_zookeeper: [ OK ] 0.72 sec.
2025-06-25 16:36:25 00463_long_sessions_in_http_interface: [ OK ] 8.24 sec.
2025-06-25 16:36:25 00332_quantile_timing_memory_leak: [ OK ] 0.27 sec.
2025-06-25 16:36:26 00309_formats_case_insensitive: [ OK ] 0.32 sec.
2025-06-25 16:36:26 00002_log_and_exception_messages_formatting: [ SKIPPED ] 0.00 sec.
2025-06-25 16:36:26 Reason: skip
2025-06-25 16:36:26
2025-06-25 16:36:26 269 tests passed. 12 tests skipped. 1191.01 s elapsed (MainProcess).
2025-06-25 16:36:26 Won't run stateful tests because test data wasn't loaded.
2025-06-25 16:36:26 Checking the hung queries: done
2025-06-25 16:36:26
2025-06-25 16:36:26 No queries hung.
2025-06-25 16:36:26
2025-06-25 16:36:26 Some tests were restarted:
2025-06-25 16:36:26
2025-06-25 16:36:26
2025-06-25 16:36:26 02221_parallel_replicas_bug :
2025-06-25 16:36:26 [ fail ] 1.62 sec.
2025-06-25 16:36:26 Reason: having stderror:
2025-06-25 16:36:26 [2c5a131a8eda] 2025.06.25 07:08:11.399944 [ 623 ] {82777838-e29f-49f4-bc26-fe3673bccff9} ConnectionPoolWithFailover: Connection failed at try №1, reason: Code: 210. DB::NetException: Connection refused (127.0.0.3:1234). (NETWORK_ERROR) (version 24.8.14.10505.altinitytest (altinity build))
2025-06-25 16:36:26
2025-06-25 16:36:26 stdout:
2025-06-25 16:36:26
2025-06-25 16:36:26
2025-06-25 16:36:26 Settings used in the test: --max_insert_threads 2 --group_by_two_level_threshold 417166 --group_by_two_level_threshold_bytes 3525048 --distributed_aggregation_memory_efficient 0 --fsync_metadata 1 --output_format_parallel_formatting 0 --input_format_parallel_parsing 1 --min_chunk_bytes_for_parallel_parsing 4193259 --max_read_buffer_size 725664 --prefer_localhost_replica 0 --max_block_size 78945 --max_joined_block_size_rows 38223 --max_threads 1 --optimize_append_index 0 --optimize_if_chain_to_multiif 1 --optimize_if_transform_strings_to_enum 1 --optimize_read_in_order 0 --optimize_or_like_chain 0 --optimize_substitute_columns 0 --enable_multiple_prewhere_read_steps 0 --read_in_order_two_level_merge_threshold 13 --optimize_aggregation_in_order 0 --aggregation_in_order_max_block_bytes 12208832 --use_uncompressed_cache 0 --min_bytes_to_use_direct_io 10737418240 --min_bytes_to_use_mmap_io 1 --local_filesystem_read_method mmap --remote_filesystem_read_method threadpool --local_filesystem_read_prefetch 0 --filesystem_cache_segments_batch_size 0 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 1 --throw_on_error_from_cache_on_write_operations 1 --remote_filesystem_read_prefetch 1 --allow_prefetched_read_pool_for_remote_filesystem 0 --filesystem_prefetch_max_memory_usage 128Mi --filesystem_prefetches_limit 10 --filesystem_prefetch_min_bytes_for_single_read_task 16Mi --filesystem_prefetch_step_marks 0 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 1 --compile_sort_description 1 --merge_tree_coarse_index_granularity 23 --optimize_distinct_in_order 0 --max_bytes_before_external_sort 10737418240 --max_bytes_before_external_group_by 74162644 --max_bytes_before_remerge_sort 998967793 --min_compress_block_size 1629172 --max_compress_block_size 1669946 --merge_tree_compact_parts_min_granules_to_multibuffer_read 65 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 4003932 --http_wait_end_of_query True --enable_memory_bound_merging_of_aggregation_results 0 --min_count_to_compile_expression 0 --min_count_to_compile_aggregate_expression 0 --min_count_to_compile_sort_description 3 --session_timezone America/Mazatlan --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction False --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.96 --prefer_external_sort_block_bytes 100000000 --cross_join_min_rows_to_compress 1 --cross_join_min_bytes_to_compress 1 --min_external_table_block_size_bytes 100000000 --max_parsing_threads 1 --optimize_functions_to_subcolumns 0 --parallel_replicas_local_plan 0
2025-06-25 16:36:26
2025-06-25 16:36:26 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 1.0 --prefer_fetch_merged_part_size_threshold 10737418240 --vertical_merge_algorithm_min_rows_to_activate 51087 --vertical_merge_algorithm_min_columns_to_activate 1 --allow_vertical_merges_from_compact_to_wide_parts 0 --min_merge_bytes_to_use_direct_io 1 --index_granularity_bytes 24544931 --merge_max_block_size 17810 --index_granularity 10325 --min_bytes_for_wide_part 0 --marks_compress_block_size 79672 --primary_key_compress_block_size 77822 --replace_long_file_name_to_hash 0 --max_file_name_length 128 --min_bytes_for_full_part_storage 385979333 --compact_parts_max_bytes_to_buffer 4221725 --compact_parts_max_granules_to_buffer 181 --compact_parts_merge_max_bytes_to_prefetch_part 23920792 --cache_populated_by_fetch 1 --concurrent_part_removal_threshold 26 --old_parts_lifetime 480
2025-06-25 16:36:26
2025-06-25 16:36:26 Database: test_qfw8lwmp
2025-06-25 16:36:26 All tests have finished.
2025-06-25 16:36:26
2025-06-25 16:36:26 Top patterns of log messages:
2025-06-25 16:36:26
2025-06-25 16:36:26 count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string
2025-06-25 16:36:26
2025-06-25 16:36:26 1. 131559 0.041 25.61 MiB 0.076 1 354 ['Debug'] 0 (from {}{}{}){}{} {} (stage: {})
2025-06-25 16:36:26 2. 131497 0.041 19.69 MiB 0.059 42450 351 ['Trace'] 1 {} Creating query context from {} context, user_id: {}, parent context user: {}
2025-06-25 16:36:26 3. 120959 0.038 5.30 MiB 0.016 1 1 ['Trace'] 1 Processing requests batch, size: {}, bytes: {}
2025-06-25 16:36:26 4. 118462 0.037 2.83 MiB 0.008 1 811 ['Trace'] 0.001 Query to stage {}{}
2025-06-25 16:36:26 5. 116973 0.037 5.49 MiB 0.016 1 811 ['Trace'] 0.001 Query from stage {} to stage {}{}
2025-06-25 16:36:26 6. 107567 0.034 2.97 MiB 0.009 1 289 ['Debug'] 0 Processed in {} sec.
2025-06-25 16:36:26 7. 90893 0.028 8.02 MiB 0.024 1 1216 ['Trace'] 0 Aggregated. {} to {} rows (from {}) in {} sec. ({:.3f} rows/sec., {}/sec.)
2025-06-25 16:36:26 8. 90555 0.028 2.87 MiB 0.009 1 1218 ['Trace'] 0 Aggregation method: {}
2025-06-25 16:36:26 9. 76649 0.024 6.08 MiB 0.018 1 343 ['Debug'] 0 Read {} rows, {} in {} sec., {} rows/sec., {}/sec.
2025-06-25 16:36:26 10. 72514 0.023 4.98 MiB 0.015 1 1855 ['Trace'] 0.539 Reserved {} on local disk {}, having unreserved {}.
2025-06-25 16:36:26 11. 69074 0.022 5.49 MiB 0.016 1 1118 ['Trace'] 0 An entry for key={} found in cache: sum_of_sizes={}, median_size={}
2025-06-25 16:36:26 12. 68530 0.021 7.63 MiB 0.023 2831 1365 ['Trace'] 0.418 Renaming temporary part {} to {} with tid {}.
2025-06-25 16:36:26 13. 64397 0.02 4.36 MiB 0.013 2819 1850 ['Trace'] 0.499 Trying to reserve {} using storage policy from min volume index {}
2025-06-25 16:36:26 14. 55341 0.017 594.48 KiB 0.002 1 1209 ['Trace'] 0 Aggregating
2025-06-25 16:36:26 15. 47695 0.015 2.15 MiB 0.006 1 1349 ['Trace'] 0.127 filled checksums {}
2025-06-25 16:36:26 16. 44355 0.014 2.09 MiB 0.006 1 337 ['Debug'] 0.224 Peak memory usage{}: {}.
2025-06-25 16:36:26 17. 43454 0.014 8.90 MiB 0.027 3 338 ['Trace'] 1 HTTP Request for {}. Method: {}, Address: {}, User-Agent: {}{}, Content Type: {}, Transfer Encoding: {}, X-Forwarded-For: {}
2025-06-25 16:36:26 18. 43445 0.014 22.29 MiB 0.066 2 338 ['Trace'] 1 Request URI: {}
2025-06-25 16:36:26 19. 43307 0.014 1.95 MiB 0.006 43307 508 ['Debug'] 0.996 Authenticating user '{}' from {}
2025-06-25 16:36:26 20. 43284 0.014 4.75 MiB 0.014 43284 508 ['Debug'] 0.996 {} Authenticated with global context as user {}
2025-06-25 16:36:26 21. 43233 0.014 3.71 MiB 0.011 43233 502 ['Debug'] 0.996 {} Logout, user_id: {}
2025-06-25 16:36:26 22. 42875 0.013 3.07 MiB 0.009 42875 352 ['Debug'] 1 Creating session context with user_id: {}
2025-06-25 16:36:26 23. 41957 0.013 3.67 MiB 0.011 442 529 ['Trace'] 0.998 Insert entry {} to queue with type {}
2025-06-25 16:36:26 24. 41324 0.013 847.46 KiB 0.002 2 338 ['Debug'] 0.508 Done processing query
2025-06-25 16:36:26 25. 38581 0.012 2.94 MiB 0.009 742 1520 ['Trace'] 0.952 Part {} is not stored on zero-copy replicated disk, blobs can be removed
2025-06-25 16:36:26 26. 37507 0.012 2.90 MiB 0.009 1610 359 ['Trace'] 0.001 Reading {} ranges in{}order from part {}, approx. {} rows starting from {}
2025-06-25 16:36:26 27. 34315 0.011 2.85 MiB 0.008 937 512 ['Trace'] 1 Scheduling next merge selecting task after {}ms, current attempt status: {}
2025-06-25 16:36:26 28. 33921 0.011 4.61 MiB 0.014 661 512 ['Trace'] 1 Checked {} partitions, found {} partitions with parts that may be merged: [{}] (max_total_size_to_merge={}, merge_with_ttl_allowed={})
2025-06-25 16:36:26 29. 31962 0.01 1.80 MiB 0.005 442 529 ['Debug'] 0.999 Pulling {} entries to queue: {} - {}
2025-06-25 16:36:26 30. 31962 0.01 811.54 KiB 0.002 442 529 ['Debug'] 0.999 Pulled {} entries to queue.
2025-06-25 16:36:26 31. 28096 0.009 2.80 MiB 0.008 274 33 ['Debug'] 1 Fetching part {} from {}:{}
2025-06-25 16:36:26 32. 27154 0.008 2.42 MiB 0.007 1 143 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part
2025-06-25 16:36:26 33. 26401 0.008 801.50 KiB 0.002 1764 416 ['Debug'] 0.004 Key condition: {}
2025-06-25 16:36:26 34. 26206 0.008 3.16 MiB 0.009 1 2 ['Trace'] 1 Creating part at path {}
2025-06-25 16:36:26 35. 25933 0.008 985.92 KiB 0.003 361 35 ['Debug'] 0.809 Committing part {} to zookeeper
2025-06-25 16:36:26 36. 25058 0.008 926.85 KiB 0.003 358 32 ['Debug'] 0.837 Part {} committed to zookeeper
2025-06-25 16:36:26 37. 24691 0.008 554.58 KiB 0.002 1 1104 ['Trace'] 0 Merging aggregated data
2025-06-25 16:36:26 38. 23036 0.007 1.93 MiB 0.006 273 39 ['Trace'] 1 Trying to fetch with zero-copy replication, but disk is not provided, will try to select
2025-06-25 16:36:26 39. 23036 0.007 832.33 KiB 0.002 273 39 ['Trace'] 1 Checking disk {} with type {}
2025-06-25 16:36:26 40. 22995 0.007 1010.52 KiB 0.003 1759 416 ['Trace'] 0.005 Filtering marks by primary and secondary keys
2025-06-25 16:36:26 41. 22732 0.007 2.53 MiB 0.008 1752 416 ['Debug'] 0.005 Selected {}/{} parts by partition key, {} parts by primary key, {}/{} marks by primary key, {} marks to read from {} ranges
2025-06-25 16:36:26 42. 22714 0.007 741.59 KiB 0.002 2 295 ['Trace'] 1 TCP Request. Address: {}
2025-06-25 16:36:26 43. 22711 0.007 2.15 MiB 0.006 1 295 ['Debug'] 1 Connected {} version {}.{}.{}, revision: {}{}{}.
2025-06-25 16:36:26 44. 22643 0.007 597.03 KiB 0.002 1 287 ['Debug'] 1 Done processing connection.
2025-06-25 16:36:26 45. 21867 0.007 1.38 MiB 0.004 89 499 ['Debug'] 1 There is no part {} in ZooKeeper, it was only in filesystem
2025-06-25 16:36:26 46. 21014 0.007 461.33 KiB 0.001 220 62 ['Trace'] 1 Sending part {}
2025-06-25 16:36:26 47. 21011 0.007 408.42 KiB 0.001 271 40 ['Debug'] 1 Downloading files {}
2025-06-25 16:36:26 48. 21008 0.007 1.74 MiB 0.005 271 40 ['Trace'] 1 Disk for fetch is not provided, getting disk from reservation {} with type '{}'
2025-06-25 16:36:26 49. 21004 0.007 932.89 KiB 0.003 268 40 ['Debug'] 1 Downloading part {} onto disk {}.
2025-06-25 16:36:26 50. 21000 0.007 1.09 MiB 0.003 268 40 ['Debug'] 1 Download of part {} onto disk {} finished.
2025-06-25 16:36:26 51. 20970 0.007 1.06 MiB 0.003 1521 409 ['Trace'] 0.005 Spreading mark ranges among streams (default reading)
2025-06-25 16:36:26 52. 20970 0.007 2.03 MiB 0.006 271 33 ['Debug'] 1 Fetched part {} from {}:{}{}
2025-06-25 16:36:26 53. 20373 0.006 2.14 MiB 0.006 1 92 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part, column {}
2025-06-25 16:36:26 54. 15605 0.005 624.81 KiB 0.002 183 638 ['Debug'] 0.638 Will use old analyzer to prepare mutation
2025-06-25 16:36:26 55. 13238 0.004 1021.29 KiB 0.003 1 295 ['Trace'] 0 Query span trace_id for opentelemetry log: {}
2025-06-25 16:36:26 56. 13159 0.004 1.59 MiB 0.005 5149 16 ['Trace'] 1 Executing log entry to merge parts {} to {}
2025-06-25 16:36:26 57. 12434 0.004 522.13 KiB 0.002 3574 327 ['Debug'] 0.011 Found {} non used tables in detached tables.
2025-06-25 16:36:26 58. 12434 0.004 740.70 KiB 0.002 3574 327 ['Debug'] 0.011 There are {} detached tables. Start searching non used tables.
2025-06-25 16:36:26 59. 11274 0.004 1.02 MiB 0.003 15 21 ['Debug'] 0 Waiting for currently running merges ({} parts are merging right now) to perform OPTIMIZE FINAL
2025-06-25 16:36:26 60. 10651 0.003 651.47 KiB 0.002 39 32 ['Debug'] 1 Part {} is rendered obsolete by fetching part {}
2025-06-25 16:36:26 61. 10604 0.003 372.81 KiB 0.001 1 196 ['Trace'] 1 Keeper request. Address: {}
2025-06-25 16:36:26 62. 10346 0.003 2.09 MiB 0.006 2618 16 ['Debug'] 1 Don't have all parts (at least {} is missing) for merge {}; will try to fetch it instead. Either pool for fetches is starving, see background_fetches_pool_size, or none of active replicas has it
2025-06-25 16:36:26 63. 9976 0.003 794.03 KiB 0.002 1 1058 ['Trace'] 0 Statistics updated for key={}: new sum_of_sizes={}, median_size={}
2025-06-25 16:36:26 64. 9077 0.003 1.28 MiB 0.004 1 269 ['Trace'] 0.017 PREWHERE condition was split into {} steps: {}
2025-06-25 16:36:26 65. 8871 0.003 277.22 KiB 0.001 1 188 ['Debug'] 1 Receive four letter command {}
2025-06-25 16:36:26 66. 8341 0.003 293.24 KiB 0.001 1 910 ['Trace'] 0.008 Converting aggregated data to blocks
2025-06-25 16:36:26 67. 8306 0.003 878.38 KiB 0.003 1 908 ['Debug'] 0.006 Converted aggregated data to blocks. {} rows, {} in {} sec. ({:.3f} rows/sec., {}/sec.)
2025-06-25 16:36:26 68. 7685 0.002 225.15 KiB 0.001 933 523 ['Debug'] 0.993 Updating strategy picker state
2025-06-25 16:36:26 69. 7612 0.002 256.34 KiB 0.001 367 245 ['Debug'] 0.001 MinMax index condition: {}
2025-06-25 16:36:26 70. 7463 0.002 356.10 KiB 0.001 674 680 ['Debug'] 0.898 Selected {} parts from {} to {}
2025-06-25 16:36:26 71. 7412 0.002 209.91 KiB 0.001 1 1080 ['Debug'] 1 Stop worker in {}
2025-06-25 16:36:26 72. 7412 0.002 516.71 KiB 0.002 1 1026 ['Debug'] 1 Finish load job '{}' with status {}
2025-06-25 16:36:26 73. 7412 0.002 545.66 KiB 0.002 1 1026 ['Debug'] 1 Execute load job '{}' in {}
2025-06-25 16:36:26 74. 7412 0.002 567.38 KiB 0.002 1 236 ['Debug'] 0.001 Schedule load job '{}' into {}
2025-06-25 16:36:26 75. 7412 0.002 289.53 KiB 0.001 1 1261 ['Debug'] 0.5 Spawn loader worker #{} in {}
2025-06-25 16:36:26 76. 7411 0.002 690.34 KiB 0.002 1 237 ['Debug'] 0 Prioritize load job '{}': {} -> {}
2025-06-25 16:36:26 77. 7388 0.002 245.30 KiB 0.001 1 1257 ['Debug'] 0.5 Change current priority: {} -> {}
2025-06-25 16:36:26 78. 7387 0.002 64.92 KiB 0 2 236 ['Trace'] 0.001 No tables
2025-06-25 16:36:26 79. 7202 0.002 271.42 KiB 0.001 311 286 ['Debug'] 0.012 Reading approx. {} rows with {} streams
2025-06-25 16:36:26 80. 6873 0.002 209.82 KiB 0.001 250 1068 ['Trace'] 0.009 Found {} range {}in {} steps
2025-06-25 16:36:26 81. 6873 0.002 196.36 KiB 0.001 250 1068 ['Trace'] 0.009 Found (LEFT) boundary mark: {}
2025-06-25 16:36:26 82. 6873 0.002 477.48 KiB 0.001 250 1068 ['Trace'] 0.009 Running binary search on index range for part {} ({} marks)
2025-06-25 16:36:26 83. 6873 0.002 203.52 KiB 0.001 250 1068 ['Trace'] 0.009 Found (RIGHT) boundary mark: {}
2025-06-25 16:36:26 84. 6647 0.002 1.30 MiB 0.004 1 1044 ['Information'] 1 Removing metadata {} of dropped table {}
2025-06-25 16:36:26 85. 6645 0.002 493.18 KiB 0.001 1 255 ['Debug'] 0 Waiting for table {} to be finally dropped
2025-06-25 16:36:26 86. 6645 0.002 765.73 KiB 0.002 1 255 ['Debug'] 0 Done waiting for the table {} to be dropped. The outcome: {}
2025-06-25 16:36:26 87. 6587 0.002 472.36 KiB 0.001 419 691 ['Debug'] 0 Wrote block with ID '{}', {} rows{}
2025-06-25 16:36:26 88. 6522 0.002 811.01 KiB 0.002 11 511 ['Debug'] 1 Not executing log entry {} of type {} for part {} because merges and mutations are cancelled now.
2025-06-25 16:36:26 89. 6268 0.002 452.98 KiB 0.001 1 512 ['Information'] 1 Have {} tables in drop queue ({} of them are in use), will try drop {} tables
2025-06-25 16:36:26 90. 5787 0.002 1.10 MiB 0.003 1 418 ['Trace'] 0.001 {}Keys: {}, datatype: {}, kind: {}, strictness: {}, right header: {}
2025-06-25 16:36:26 91. 5603 0.002 431.64 KiB 0.001 1 170 ['Debug'] 0 Merging {} parts: from {} to {} into {} with storage {}
2025-06-25 16:36:26 92. 5603 0.002 191.00 KiB 0.001 1 170 ['Debug'] 0 Selected MergeAlgorithm: {}
2025-06-25 16:36:26 93. 5593 0.002 720.50 KiB 0.002 1 170 ['Debug'] 0 Merge sorted {} rows, containing {} columns ({} merged, {} gathered) in {} sec., {} rows/sec., {}/sec.
2025-06-25 16:36:26 94. 5574 0.002 322.44 KiB 0.001 529 169 ['Trace'] 0 Merged {} parts: [{}, {}] -> {}
2025-06-25 16:36:26 95. 5464 0.002 691.09 KiB 0.002 2325 1445 ['Debug'] 0.977 Removing {} parts from filesystem (serially): Parts: [{}]
2025-06-25 16:36:26 96. 5095 0.002 333.36 KiB 0.001 79 22 ['Information'] 1 Fetching of part was cancelled
2025-06-25 16:36:26 97. 5056 0.002 367.59 KiB 0.001 1 274 ['Trace'] 0.011 The min valid primary key position for moving to the tail of PREWHERE is {}
2025-06-25 16:36:26 98. 4977 0.002 257.84 KiB 0.001 1 16 ['Trace'] 0 Mutating part {} to mutation version {}
2025-06-25 16:36:26 99. 4868 0.002 177.39 KiB 0.001 18 18 ['Trace'] 1 Flushed system log up to offset {}
2025-06-25 16:36:26 100. 4868 0.002 284.93 KiB 0.001 18 18 ['Trace'] 1 Flushing system log, {} entries to flush up to offset {}
2025-06-25 16:36:26
2025-06-25 16:36:26 count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string
2025-06-25 16:36:26
2025-06-25 16:36:26
2025-06-25 16:36:26
2025-06-25 16:36:26 Top messages without format string (fmt::runtime):
2025-06-25 16:36:26
2025-06-25 16:36:26 count pattern runtime_message line
2025-06-25 16:36:26
2025-06-25 16:36:26 1. 1652 IfthesignaturecheckfailedThiscou If the signature check failed. This could be because of a time skew. Attempting to adjust the signer. ('/AWSLogger.cpp',71)
2025-06-25 16:36:26 2. 26 CodeDBExceptionSyntaxerrorfailed Code: 62. DB::Exception: Syntax error: failed at position 27 ('expand'): expand c, d;. Max query size exceeded: 'expand'. (SYNTAX_ERROR) (version 24.8.14.10505.altinitytest (altinity build)) (from [::1]:33226) (comment: 02366_kql_mvexpand.sql) (in query: m ('/executeQuery.cpp',221)
2025-06-25 16:36:26 3. 14 CodeDBExceptionReceivedfromDBExc Code: 516. DB::Exception: Received from 127.0.0.2:9000. DB::Exception: default: Authentication failed: password is incorrect, or there is no user with such name.
2025-06-25 16:36:26
2025-06-25 16:36:26 If you have installed ClickHouse and forgot password you can reset it in the configuration fi ('/executeQuery.cpp',221)
2025-06-25 16:36:26 4. 8 CodeCoordinationExceptionFaultin Code: 999. Coordination::Exception: Fault injection before operation. (KEEPER_EXCEPTION) (version 24.8.14.10505.altinitytest (altinity build)) (from [::1]:41944) (comment: 02456_keeper_retries_during_insert.sql) (in query: INSERT INTO keeper_retries_r1 SET ('/executeQuery.cpp',221)
2025-06-25 16:36:26 5. 8 CodeDBExceptionReceivedfromlocal Code: 60. DB::Exception: Received from localhost:9000. DB::Exception: Table shard_1.data_01850 does not exist. Maybe you meant shard_1.data_02346?. Stack trace:
2025-06-25 16:36:26
2025-06-25 16:36:26 0. /build/contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String ('/executeQuery.cpp',221)
2025-06-25 16:36:26 6. 4 CodeDBExceptionTherequestsignatu Code: 499. DB::Exception: The request signature we calculated does not match the signature you provided. Check your key and signing method. (S3_ERROR) (version 24.8.14.10505.altinitytest (altinity build)) (from [::1]:36298) (comment: 02843_backup_use_same_ ('/executeQuery.cpp',221)
2025-06-25 16:36:26 7. 4 CodeDBExceptionExpectedargumento Code: 395. DB::Exception: Expected argument of data type real: while executing 'FUNCTION throwIf(_CAST(true_Bool, 'Bool'_String) :: 1, 'Expected argument of data type real'_String :: 2) -> throwIf(_CAST(true_Bool, 'Bool'_String), 'Expected argument of data ('/executeQuery.cpp',221)
2025-06-25 16:36:26 8. 4 CodeDBExceptionEmptyqueryInscope Code: 62. DB::Exception: Empty query: In scope SELECT formatQuery(''). (SYNTAX_ERROR) (version 24.8.14.10505.altinitytest (altinity build)) (from [::1]:33762) (comment: 02882_formatQuery.sql) (in query: SELECT formatQuery('');), Stack trace (when copying t ('/executeQuery.cpp',221)
2025-06-25 16:36:26 9. 3 PocoExceptionCodeecodeBadURIsynt Poco::Exception. Code: 1000, e.code() = 0, Bad URI syntax: URI contains invalid characters (version 24.8.14.10505.altinitytest (altinity build)) (from [::1]:60998) (comment: 00746_sql_fuzzy.sh) (in query: SELECT * FROM hudi('\0');), Stack trace (when copyi ('/executeQuery.cpp',221)
2025-06-25 16:36:26 10. 3 CodeDBExceptionBadURIsyntaxURIco Code: 1000. DB::Exception: Bad URI syntax: URI contains invalid characters. (POCO_EXCEPTION), Stack trace (when copying this message, always include the lines below):
2025-06-25 16:36:26
2025-06-25 16:36:26 0. /build/contrib/llvm-project/libcxx/include/exception:141: Poco::URISyntaxException::U ('/TCPHandler.cpp',765)
2025-06-25 16:36:26 11. 2 CodeDBExceptionSyntaxerrorcolumn Code: 62. DB::Exception: Syntax error (columns declaration list): failed at position 4 (end of query): . Expected one of: NULL, NOT, DEFAULT, MATERIALIZED, EPHEMERAL, ALIAS, AUTO_INCREMENT, PRIMARY KEY, data type, identifier. (SYNTAX_ERROR) (version 24.8.1 ('/executeQuery.cpp',221)
2025-06-25 16:36:26 12. 2 CodeDBExceptionEmptyquerySYNTAXE Code: 62. DB::Exception: Empty query. (SYNTAX_ERROR) (version 24.8.14.10505.altinitytest (altinity build)) (from [::ffff:127.0.0.1]:45826) (in query: ), Stack trace (when copying this message, always include the lines below):
2025-06-25 16:36:26
2025-06-25 16:36:26 0. /build/contrib/llvm-projec ('/executeQuery.cpp',221)
2025-06-25 16:36:26 13. 2 createsnapshotidxlogterm create snapshot idx 100000 log_term 1 ('/LoggerWrapper.h',43)
2025-06-25 16:36:26 14. 2 CodeDBExceptionSyntaxerrordataty Code: 62. DB::Exception: Syntax error (data type): failed at position 1 (' '): . Unrecognized token: ' ': In scope SELECT getTypeSerializationStreams('\0'). (SYNTAX_ERROR) (version 24.8.14.10505.altinitytest (altinity build)) (from [::1]:60998) (comment: ('/executeQuery.cpp',221)
2025-06-25 16:36:26 15. 2 creatingasnapshotforindex creating a snapshot for index 100000 ('/LoggerWrapper.h',43)
2025-06-25 16:36:26 16. 2 CodeDBExceptionThereisnosubtypef Code: 386. DB::Exception: There is no subtype for types String, UInt8 because some of them are String/FixedString and some of them are not: In scope SELECT ['1', '2'] AS arr1, [1, 2] AS arr2, round(arrayJaccardIndex(arr1, arr2), 2). (NO_COMMON_TYPE) (versi ('/executeQuery.cpp',221)
2025-06-25 16:36:26 17. 2 snapshotidxlogtermcreatedcompact snapshot idx 100000 log_term 1 created, compact the log store if needed ('/LoggerWrapper.h',43)
2025-06-25 16:36:26 18. 2 CodeDBExceptionOutofmemoryalloca Code: 173. DB::Exception: Out of memory: allocation of size 80003648 failed: (in file/uri /var/lib/clickhouse/user_files/03147_parquet_memory_tracking.parquet): While executing ParquetBlockInputFormat: While executing File. (CANNOT_ALLOCATE_MEMORY) (versio ('/executeQuery.cpp',221)
2025-06-25 16:36:26 19. 2 CodeDBExceptionFailedtogetobject Code: 499. DB::Exception: Failed to get object info: No response body.. HTTP response code: 404: while reading test: The table structure cannot be extracted from a CSV format file. You can specify the structure manually. (S3_ERROR) (version 24.8.14.10505.a ('/executeQuery.cpp',221)
2025-06-25 16:36:26 20. 2 createsnapshotidxlogtermdoneusel create snapshot idx 100000 log_term 1 done: 36 us elapsed ('/LoggerWrapper.h',43)
2025-06-25 16:36:26 count pattern runtime_message line
2025-06-25 16:36:26
2025-06-25 16:36:26 21. 1 configatindexiscommittedprevconf config at index 1 is committed, prev config log idx 0 ('/LoggerWrapper.h',43)
2025-06-25 16:36:26 22. 1 waitforHBforms wait for HB, for 50 + [0, 0] ms ('/LoggerWrapper.h',43)
2025-06-25 16:36:26 23. 1 invalidelectiontimeoutupperbound invalid election timeout upper bound detected, adjusted to 0 ('/LoggerWrapper.h',43)
2025-06-25 16:36:26 24. 1 BECOMELEADERappendednewconfigat [BECOME LEADER] appended new config at 1 ('/LoggerWrapper.h',43)
2025-06-25 16:36:26 count pattern runtime_message line
2025-06-25 16:36:26
2025-06-25 16:36:26 25. 1 newelectiontimeoutrange new election timeout range: 0 - 0 ('/LoggerWrapper.h',43)
2025-06-25 16:36:26 26. 1 StartingClickHousealtinitytestre Starting ClickHouse 24.8.14.10505.altinitytest (revision: 4294967295, git hash: 9c87a1767af23bdd3d0b18ad701b2f0be92808e3, build id: E826225D4A9519F7B683D7DDBB5491AF7F412B52), PID 615 ('',0)
2025-06-25 16:36:26 27. 1 stdexceptionCodetypestdruntimeer std::exception. Code: 1001, type: std::runtime_error, e.what() = ran out of bytes (version 24.8.14.10505.altinitytest (altinity build)) (from [::1]:40792) (comment: 02688_aggregate_states.sql) (in query: SELECT '\x01\x01\x01'::AggregateFunction(groupBitmap ('/executeQuery.cpp',221)
2025-06-25 16:36:26 28. 1 numberofpendingcommitelements number of pending commit elements: 0 ('/LoggerWrapper.h',43)
2025-06-25 16:36:26 29. 1 Electiontimeoutinitiateleaderele Election timeout, initiate leader election ('/LoggerWrapper.h',43)
2025-06-25 16:36:30 30. 1 RaftASIOlistenerinitiatedonunsec Raft ASIO listener initiated on :::9234, unsecured ('/LoggerWrapper.h',43)
2025-06-25 16:36:30
2025-06-25 16:36:30
2025-06-25 16:36:30
2025-06-25 16:36:30 Top messages not matching their format strings:
2025-06-25 16:36:30
2025-06-25 16:36:30 message_format_string count() any_message
2025-06-25 16:36:30
2025-06-25 16:36:30 1. 1691 If the signature check failed. This could be because of a time skew. Attempting to adjust the signer.
2025-06-25 16:36:30 message_format_string count() any_message
2025-06-25 16:36:30
2025-06-25 16:36:30 2. Illegal UTF-8 sequence, while processing '{}' 12 Code: 36. DB::Exception: Illegal UTF-8 sequence, while processing '�': while executing 'FUNCTION stringJaccardIndexUTF8(materialize('hello'_String) :: 3, materialize('�'_String) :: 1) -> stringJaccardIndexUTF8(materialize('hello'_String), materialize('�'_String)) Float64 : 2'. (BAD_ARGUMENTS) (version 24.8.14.10505.altinitytest (altinity build)) (from [::1]:38062) (comment: 02884_string_distance_function.sql) (in query: SELECT stringJaccardIndexUTF8(materialize('hello'), materialize('\xC2\x01'));), Stack trace (when copying this message, always include the lines below):
2025-06-25 16:36:30
2025-06-25 16:36:30 0. /build/contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x00000000164836b2
2025-06-25 16:36:30 1. /build/src/Common/Exception.cpp:111: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000000c650159
2025-06-25 16:36:30 2. /build/contrib/llvm-project/libcxx/include/string:1499: DB::Exception::Exception(PreformattedMessage&&, int) @ 0x000000000700f16c
2025-06-25 16:36:30 3. /build/contrib/llvm-project/libcxx/include/vector:438: DB::Exception::Exception(int, FormatStringHelperImpl::type>, StringRef&&) @ 0x0000000007af6fcb
2025-06-25 16:36:30 4. /build/src/Functions/FunctionsStringDistance.cpp:0: DB::parseUTF8String(char const*, unsigned long, std::function, std::function) @ 0x0000000007af681c
2025-06-25 16:36:30 5. /build/contrib/llvm-project/libcxx/include/__functional/function.h:818: ? @ 0x0000000007b007b7
2025-06-25 16:36:30 6. /build/src/Common/PODArray.h:208: DB::FunctionStringDistanceImpl>::vectorVector(DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul>&, unsigned long) @ 0x0000000007b003cf
2025-06-25 16:36:30 7. /build/src/Functions/FunctionsStringSimilarity.h:0: DB::FunctionsStringSimilarity>, DB::NameJaccardIndexUTF8>::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x0000000007affc2f
2025-06-25 16:36:30 8. /build/src/Functions/IFunctionAdaptors.h:22: DB::FunctionToExecutableFunctionAdaptor::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000000702497a
2025-06-25 16:36:30 9. /build/contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::IExecutableFunction::executeWithoutLowCardinalityColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b67ca5
2025-06-25 16:36:30 10. /build/contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::IExecutableFunction::executeWithoutSparseColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b6871a
2025-06-25 16:36:30 11. /build/src/Functions/IFunction.cpp:0: DB::IExecutableFunction::execute(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b69645
2025-06-25 16:36:30 12. /build/contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::ExpressionActions::execute(DB::Block&, unsigned long&, bool, bool) const @ 0x0000000011197e1d
2025-06-25 16:36:30 13. /build/src/Processors/Transforms/ExpressionTransform.cpp:0: DB::ExpressionTransform::transform(DB::Chunk&) @ 0x0000000012fadb76
2025-06-25 16:36:30 14. /build/contrib/llvm-project/libcxx/include/__utility/swap.h:35: DB::ISimpleTransform::transform(DB::Chunk&, DB::Chunk&) @ 0x000000000c90a7d3
2025-06-25 16:36:30 15. /build/src/Processors/ISimpleTransform.cpp:99: DB::ISimpleTransform::work() @ 0x0000000012d50a69
2025-06-25 16:36:30 16. /build/src/Processors/Executors/ExecutionThreadContext.cpp:0: DB::ExecutionThreadContext::executeTask() @ 0x0000000012d6b289
2025-06-25 16:36:30 17. /build/src/Processors/Executors/PipelineExecutor.cpp:273: DB::PipelineExecutor::executeStepImpl(unsigned long, std::atomic*) @ 0x0000000012d60f30
2025-06-25 16:36:30 18. /build/contrib/llvm-project/libcxx/include/vector:547: DB::PipelineExecutor::executeSingleThread(unsigned long) @ 0x0000000012d611bd
2025-06-25 16:36:30 19. /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:701: DB::PipelineExecutor::executeImpl(unsigned long, bool) @ 0x0000000012d6002c
2025-06-25 16:36:30 20. /build/contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:274: DB::PipelineExecutor::execute(unsigned long, bool) @ 0x0000000012d5fa45
2025-06-25 16:36:30 21. /build/src/Processors/Executors/PullingAsyncPipelineExecutor.cpp:0: void std::__function::__policy_invoker::__call_impl::ThreadFromGlobalPoolImpl(DB::PullingAsyncPipelineExecutor::pull(DB::Chunk&, unsigned long)::$_0&&)::'lambda'(), void ()>>(std::__function::__policy_storage const*) @ 0x0000000012d6e10a
2025-06-25 16:36:30 22. /build/base/base/../base/wide_integer_impl.h:817: ThreadPoolImpl::ThreadFromThreadPool::worker() @ 0x000000000c704d0e
2025-06-25 16:36:30 23. /build/contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:302: void* std::__thread_proxy[abi:v15007]>, void (ThreadPoolImpl::ThreadFromThreadPool::*)(), ThreadPoolImpl::ThreadFromThreadPool*>>(void*) @ 0x000000000c70a172
2025-06-25 16:36:30 24. ? @ 0x00007f6319a8cac3
2025-06-25 16:36:30 25. ? @ 0x00007f6319b1e850
2025-06-25 16:36:30
2025-06-25 16:36:30 message_format_string count() any_message
2025-06-25 16:36:30
2025-06-25 16:36:30 3. Close WriteBufferFromAzureBlobStorage. {}. 4 Close WriteBufferFromAzureBlobStorage. etvvhiwaxfvgfwyxgnnbpjfpgljjlfda. (LogSeriesLimiter: on interval from 2025-06-25 16:24:47 to 2025-06-25 16:25:10 accepted series 1 / 10 for the logger WriteBufferFromAzureBlobStorage)
2025-06-25 16:36:30 message_format_string count() any_message
2025-06-25 16:36:30
2025-06-25 16:36:30 4. Substitution '\{}' in replacement argument is invalid, regexp has only {} capturing groups 4 Code: 36. DB::Exception: Substitution '\1' in replacement argument is invalid, regexp has only 0 capturing groups. (BAD_ARGUMENTS) (version 24.8.14.10505.altinitytest (altinity build)) (from [::1]:42364) (comment: 02864_replace_regexp_string_fallback.sql) (in query: -- negative tests
2025-06-25 16:36:30 -- Even if the fallback is used, invalid substitutions must throw an exception.
2025-06-25 16:36:30 SELECT 'Hello' AS haystack, 'l' AS needle, '\\1' AS replacement, replaceRegexpOne(materialize(haystack), needle, replacement);), Stack trace (when copying this message, always include the lines below):
2025-06-25 16:36:30
2025-06-25 16:36:30 0. /build/contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x00000000164836b2
2025-06-25 16:36:30 1. /build/src/Common/Exception.cpp:111: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000000c650159
2025-06-25 16:36:30 2. /build/contrib/llvm-project/libcxx/include/string:1499: DB::Exception::Exception(PreformattedMessage&&, int) @ 0x000000000700f16c
2025-06-25 16:36:30 3. /build/contrib/llvm-project/libcxx/include/vector:438: DB::Exception::Exception(int, FormatStringHelperImpl::type, std::type_identity::type>, int&, int&&) @ 0x000000000b5807ab
2025-06-25 16:36:30 4. /build/src/Functions/ReplaceRegexpImpl.h:0: DB::ReplaceRegexpImpl::checkSubstitutions(std::basic_string_view>, int) @ 0x000000000b584eee
2025-06-25 16:36:30 5. /build/contrib/llvm-project/libcxx/include/string:1624: DB::FunctionStringReplace, DB::(anonymous namespace)::NameReplaceRegexpOne>::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000000b581b51
2025-06-25 16:36:30 6. /build/src/Functions/IFunction.h:448: DB::IFunction::executeImplDryRun(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000000700e34a
2025-06-25 16:36:30 7. /build/src/Functions/IFunctionAdaptors.h:28: DB::FunctionToExecutableFunctionAdaptor::executeDryRunImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x00000000070249da
2025-06-25 16:36:30 8. /build/src/Functions/IFunction.cpp:0: DB::IExecutableFunction::executeWithoutLowCardinalityColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b67c8f
2025-06-25 16:36:30 9. /build/contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::IExecutableFunction::executeWithoutSparseColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b6871a
2025-06-25 16:36:30 10. /build/src/Functions/IFunction.cpp:0: DB::IExecutableFunction::execute(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b69645
2025-06-25 16:36:30 11. /build/contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::ActionsDAG::evaluatePartialResult(std::unordered_map, std::equal_to, std::allocator>>&, std::vector> const&, unsigned long, bool) @ 0x0000000010fcbd01
2025-06-25 16:36:30 12. /build/src/Interpreters/ActionsDAG.cpp:0: DB::ActionsDAG::updateHeader(DB::Block const&) const @ 0x0000000010fcad14
2025-06-25 16:36:30 13. /build/src/Processors/Transforms/ExpressionTransform.cpp:10: DB::ExpressionTransform::transformHeader(DB::Block const&, DB::ActionsDAG const&) @ 0x0000000012fad832
2025-06-25 16:36:30 14. /build/src/Processors/QueryPlan/ExpressionStep.cpp:20: DB::ExpressionStep::ExpressionStep(DB::DataStream const&, DB::ActionsDAG) @ 0x00000000131409b4
2025-06-25 16:36:30 15. /build/contrib/llvm-project/libcxx/include/vector:438: std::__unique_if::__unique_single std::make_unique[abi:v15007](DB::DataStream const&, DB::ActionsDAG&&) @ 0x00000000104c52fa
2025-06-25 16:36:30 16. /build/src/Planner/Planner.cpp:0: DB::(anonymous namespace)::addExpressionStep(DB::QueryPlan&, std::shared_ptr&, String const&, std::unordered_set, std::hash>, std::equal_to>, std::allocator>>&) @ 0x0000000011654e1c
2025-06-25 16:36:30 17. /build/contrib/llvm-project/libcxx/include/string:1499: DB::Planner::buildPlanForQueryNode() @ 0x000000001164f28a
2025-06-25 16:36:30 18. /build/src/Planner/Planner.cpp:0: DB::Planner::buildQueryPlanIfNeeded() @ 0x000000001164a77e
2025-06-25 16:36:30 19. /build/src/Planner/Planner.h:44: DB::InterpreterSelectQueryAnalyzer::getQueryPlan() @ 0x000000001164896d
2025-06-25 16:36:30 20. /build/src/Interpreters/executeQuery.cpp:1182: DB::executeQueryImpl(char const*, char const*, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum, DB::ReadBuffer*) @ 0x0000000011910a6d
2025-06-25 16:36:30 21. /build/src/Interpreters/executeQuery.cpp:1397: DB::executeQuery(String const&, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum) @ 0x000000001190c6dd
2025-06-25 16:36:30 22. /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:612: DB::TCPHandler::runImpl() @ 0x0000000012cb549b
2025-06-25 16:36:30 23. /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:593: DB::TCPHandler::run() @ 0x0000000012ccbc59
2025-06-25 16:36:30 24. /build/base/poco/Net/src/TCPServerConnection.cpp:57: Poco::Net::TCPServerConnection::start() @ 0x0000000016528c87
2025-06-25 16:36:30 25. /build/contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:48: Poco::Net::TCPServerDispatcher::run() @ 0x000000001652915e
2025-06-25 16:36:30 26. /build/base/poco/Foundation/src/ThreadPool.cpp:219: Poco::PooledThread::run() @ 0x00000000164d5972
2025-06-25 16:36:30 27. /build/base/poco/Foundation/include/Poco/AutoPtr.h:77: Poco::ThreadImpl::runnableEntry(void*) @ 0x00000000164d3683
2025-06-25 16:36:30 28. ? @ 0x00007f6319a8cac3
2025-06-25 16:36:30 29. ? @ 0x00007f6319b1e850
2025-06-25 16:36:30
2025-06-25 16:36:30 message_format_string count() any_message
2025-06-25 16:36:30
2025-06-25 16:36:30 5. (from {}{}{}){}{} {} (stage: {}) 3 (from [::1]:39148) (comment: 02687_native_fuzz.sql) -- It correctly throws exception about incorrect data instead of a low-level exception about the allocator:
2025-06-25 16:36:30 SELECT * FROM format(Native, 'WatchID Int64, JavaEnable Int16, UTMCaTitle String, GoodEvent Int16, EventTime DateTime, EventDate Date, Countem String, FromTag String, HasGCLID Int16, RefererHash Int64, URLHash Int64, CLID Int16', $$
� �'�X+�'�X+�'�URLHashInt64�|3�b.�|3�b.�|3�b.�|3�b.�
2025-06-25 16:36:30 o�e�
�#�\X-h�X v�v�h�9�D�|3�b.�CLIDInt32 � $$); (stage: Complete)
2025-06-25 16:36:30 message_format_string count() any_message
2025-06-25 16:36:30
2025-06-25 16:36:30 6. Unbalanced {{ and }} in string with macros: '{}' 2 Code: 62. DB::Exception: Unbalanced { and } in string with macros: '&{@_G'. (SYNTAX_ERROR) (version 24.8.14.10505.altinitytest (altinity build)) (from [::1]:47118) (comment: 00746_sql_fuzzy.sh) (in query: SELECT [], (CAST((( SELECT * FROM fileCluster('&{@_G', (CAST(('\0') AS String))) ) , ( SELECT * FROM file() ) ) AS DateTime)), [[( SELECT [''], '' ) AS sr]];), Stack trace (when copying this message, always include the lines below):
2025-06-25 16:36:30
2025-06-25 16:36:30 0. /build/contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x00000000164836b2
2025-06-25 16:36:30 1. /build/src/Common/Exception.cpp:111: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000000c650159
2025-06-25 16:36:30 2. /build/contrib/llvm-project/libcxx/include/string:1499: DB::Exception::Exception(PreformattedMessage&&, int) @ 0x000000000700f16c
2025-06-25 16:36:30 3. /build/contrib/llvm-project/libcxx/include/vector:438: DB::Exception::Exception(int, FormatStringHelperImpl::type>, String const&) @ 0x000000000702000b
2025-06-25 16:36:30 4. /build/src/Common/Macros.cpp:88: DB::Macros::expand(String const&, DB::Macros::MacroExpansionInfo&) const @ 0x000000000c667e0b
2025-06-25 16:36:30 5. /build/src/Common/Macros.cpp:0: DB::Macros::expand(String const&) const @ 0x000000000c6683e1
2025-06-25 16:36:30 6. /build/src/Interpreters/Cluster.cpp:305: DB::Clusters::getCluster(String const&) const @ 0x00000000110cb6ac
2025-06-25 16:36:30 7. /build/contrib/llvm-project/libcxx/include/__utility/swap.h:37: DB::Context::tryGetCluster(String const&) const @ 0x00000000110f5c66
2025-06-25 16:36:30 8. /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:701: DB::ITableFunctionCluster::parseArgumentsImpl(absl::InlinedVector, 7ul, std::allocator>>&, std::shared_ptr const&) @ 0x0000000010280f8e
2025-06-25 16:36:30 9. /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:701: DB::ITableFunctionFileLike::parseArguments(std::shared_ptr const&, std::shared_ptr) @ 0x000000001027f22a
2025-06-25 16:36:30 10. /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:701: DB::ITableFunctionCluster::parseArguments(std::shared_ptr const&, std::shared_ptr) @ 0x0000000010280ce4
2025-06-25 16:36:30 11. /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:815: DB::QueryAnalyzer::resolveTableFunction(std::shared_ptr&, DB::IdentifierResolveScope&, DB::QueryExpressionsAliasVisitor&, bool) @ 0x000000001103bd4b
2025-06-25 16:36:30 12. /build/src/Analyzer/Resolve/QueryAnalyzer.cpp:0: DB::QueryAnalyzer::resolveQueryJoinTreeNode(std::shared_ptr&, DB::IdentifierResolveScope&, DB::QueryExpressionsAliasVisitor&) @ 0x00000000110604e1
2025-06-25 16:36:30 13. /build/src/Analyzer/Resolve/QueryAnalyzer.cpp:5422: DB::QueryAnalyzer::resolveQuery(std::shared_ptr const&, DB::IdentifierResolveScope&) @ 0x000000001103272e
2025-06-25 16:36:30 14. /build/src/Analyzer/Resolve/QueryAnalyzer.cpp:3783: DB::QueryAnalyzer::resolveExpressionNode(std::shared_ptr&, DB::IdentifierResolveScope&, bool, bool, bool) @ 0x000000001103908f
2025-06-25 16:36:30 15. /build/src/Analyzer/Resolve/QueryAnalyzer.cpp:3910: DB::QueryAnalyzer::resolveExpressionNodeList(std::shared_ptr&, DB::IdentifierResolveScope&, bool, bool) @ 0x0000000011038300
2025-06-25 16:36:30 16. /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:815: DB::QueryAnalyzer::resolveFunction(std::shared_ptr&, DB::IdentifierResolveScope&) @ 0x000000001104c984
2025-06-25 16:36:30 17. /build/contrib/llvm-project/libcxx/include/vector:553: DB::QueryAnalyzer::resolveExpressionNode(std::shared_ptr&, DB::IdentifierResolveScope&, bool, bool, bool) @ 0x00000000110391bc
2025-06-25 16:36:30 18. /build/src/Analyzer/Resolve/QueryAnalyzer.cpp:3910: DB::QueryAnalyzer::resolveExpressionNodeList(std::shared_ptr&, DB::IdentifierResolveScope&, bool, bool) @ 0x0000000011038300
2025-06-25 16:36:30 19. /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:815: DB::QueryAnalyzer::resolveFunction(std::shared_ptr&, DB::IdentifierResolveScope&) @ 0x000000001104c984
2025-06-25 16:36:30 20. /build/contrib/llvm-project/libcxx/include/vector:553: DB::QueryAnalyzer::resolveExpressionNode(std::shared_ptr&, DB::IdentifierResolveScope&, bool, bool, bool) @ 0x00000000110391bc
2025-06-25 16:36:30 21. /build/src/Analyzer/Resolve/QueryAnalyzer.cpp:3910: DB::QueryAnalyzer::resolveExpressionNodeList(std::shared_ptr&, DB::IdentifierResolveScope&, bool, bool) @ 0x0000000011038300
2025-06-25 16:36:30 22. /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:815: DB::QueryAnalyzer::resolveProjectionExpressionNodeList(std::shared_ptr&, DB::IdentifierResolveScope&) @ 0x000000001105e689
2025-06-25 16:36:30 23. /build/contrib/llvm-project/libcxx/include/vector:961: DB::QueryAnalyzer::resolveQuery(std::shared_ptr const&, DB::IdentifierResolveScope&) @ 0x000000001103279e
2025-06-25 16:36:30 24. /build/src/Analyzer/Resolve/QueryAnalyzer.cpp:0: DB::QueryAnalyzer::resolve(std::shared_ptr&, std::shared_ptr const&, std::shared_ptr) @ 0x0000000011031af9
2025-06-25 16:36:30 25. /build/src/Analyzer/Resolve/QueryAnalysisPass.cpp:0: DB::QueryAnalysisPass::run(std::shared_ptr&, std::shared_ptr) @ 0x00000000110313ce
2025-06-25 16:36:30 26. /build/contrib/llvm-project/libcxx/include/vector:547: DB::QueryTreePassManager::run(std::shared_ptr) @ 0x0000000011583fca
2025-06-25 16:36:30 27. /build/src/Interpreters/InterpreterSelectQueryAnalyzer.cpp:0: DB::(anonymous namespace)::buildQueryTreeAndRunPasses(std::shared_ptr const&, DB::SelectQueryOptions const&, std::shared_ptr const&, std::shared_ptr const&) @ 0x0000000011647f76
2025-06-25 16:36:30 28. /build/src/Interpreters/InterpreterSelectQueryAnalyzer.cpp:160: DB::InterpreterSelectQueryAnalyzer::InterpreterSelectQueryAnalyzer(std::shared_ptr const&, std::shared_ptr const&, DB::SelectQueryOptions const&, std::vector> const&) @ 0x0000000011646469
2025-06-25 16:36:30 29. /build/contrib/llvm-project/libcxx/include/vector:438: std::__unique_if::__unique_single std::make_unique[abi:v15007]&, std::shared_ptr const&, DB::SelectQueryOptions const&>(std::shared_ptr&, std::shared_ptr const&, DB::SelectQueryOptions const&) @ 0x0000000011648d64
2025-06-25 16:36:30 30. /build/src/Interpreters/InterpreterFactory.cpp:0: DB::InterpreterFactory::get(std::shared_ptr&, std::shared_ptr, DB::SelectQueryOptions const&) @ 0x00000000115f21e4
2025-06-25 16:36:32 31. /build/contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:302: DB::executeQueryImpl(char const*, char const*, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum, DB::ReadBuffer*) @ 0x00000000119108c9
2025-06-25 16:36:32
2025-06-25 16:36:32
2025-06-25 16:36:32
2025-06-25 16:36:32 Top short messages:
2025-06-25 16:36:32
2025-06-25 16:36:32 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2025-06-25 16:36:32
2025-06-25 16:36:32 1. 113 {} Server was built in debug mode. It will work slowly. 26
2025-06-25 16:36:32 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2025-06-25 16:36:32
2025-06-25 16:36:32 2. 19 Creating {}: {} Creating table test_qmbk8ex2.data_1: CREATE TABLE IF NOT EXISTS test_qmbk8ex2.data_1 UUID 'cff1a00c-c026-4c87-b335-a61cf 124
2025-06-25 16:36:32 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2025-06-25 16:36:32
2025-06-25 16:36:32 3. 12 Froze {} parts Froze 1 parts -13
2025-06-25 16:36:32 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2025-06-25 16:36:32
2025-06-25 16:36:32 4. 6 Bad SSH public key provided Code: 706. DB::Exception: Bad SSH public key provided. (LIBSSH_ERROR) (version 24.8.14.10505.altinitytest (altinity buil 29
2025-06-25 16:36:32 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2025-06-25 16:36:32
2025-06-25 16:36:32 5. 4 Unknown data type family: {} Code: 50. DB::Exception: Unknown data type family: ab. (UNKNOWN_TYPE), Stack trace (when copying this message, always in 29
2025-06-25 16:36:32 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2025-06-25 16:36:32
2025-06-25 16:36:32 6. 2 Unknown setting '{}' Code: 115. DB::Exception: Unknown setting 'xxx_yyy'. (UNKNOWN_SETTING), Stack trace (when copying this message, always i 27
2025-06-25 16:36:32 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2025-06-25 16:36:32
2025-06-25 16:36:32 7. 2 Database {} does not exist Code: 81. DB::Exception: Database `\0` does not exist. (UNKNOWN_DATABASE) (version 24.8.14.10505.altinitytest (altinity 29
2025-06-25 16:36:32 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2025-06-25 16:36:32
2025-06-25 16:36:32 8. 2 Substitution {} is not set Code: 456. DB::Exception: Substitution `s` is not set. (UNKNOWN_QUERY_PARAMETER) (version 24.8.14.10505.altinitytest (al 29
2025-06-25 16:36:32 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2025-06-25 16:36:32
2025-06-25 16:36:32 9. 2 Unknown table engine {} Code: 56. DB::Exception: Unknown table engine s3. (UNKNOWN_STORAGE) (version 24.8.14.10505.altinitytest (altinity build) 24
2025-06-25 16:36:32 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2025-06-25 16:36:32
2025-06-25 16:36:32 10. 2 Invalid cache key hex: {} Code: 36. DB::Exception: Invalid cache key hex: kek. (BAD_ARGUMENTS) (version 24.8.14.10505.altinitytest (altinity build 27
2025-06-25 16:36:32 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2025-06-25 16:36:32
2025-06-25 16:36:32 11. 2 Table {} is not empty Code: 705. DB::Exception: Table tab2 is not empty. (TABLE_NOT_EMPTY) (version 24.8.14.10505.altinitytest (altinity build 25
2025-06-25 16:36:32
2025-06-25 16:36:32
2025-06-25 16:36:32
2025-06-25 16:36:32 Top messages by level:
2025-06-25 16:36:32
2025-06-25 16:36:32 (0.0007632381450089889,'Failed to push block to view {}, {}') Error
2025-06-25 16:36:32 (0.00022405843043314314,'Not enabled four letter command {}') Warning
2025-06-25 16:36:32 (0.0020800508199568467,'Removing metadata {} of dropped table {}') Information
2025-06-25 16:36:32 (0.041170110730552524,'(from {}{}{}){}{} {} (stage: {})') Debug
2025-06-25 16:36:32 (0.04115070902288932,'{} Creating query context from {} context, user_id: {}, parent context user: {}') Trace
2025-06-25 16:36:32
2025-06-25 16:36:32
+ set -e
Files in current directory
+ echo 'Files in current directory'
+ ls -la ./
total 129392
drwxr-xr-x 1 root root 4096 Jun 25 16:29 .
drwxr-xr-x 1 root root 4096 Jun 25 16:29 ..
-rw-rw-r-- 1 1000 1000 119 Jun 25 16:02 analyzer_tech_debt.txt
-rw-rw-r-- 1 root root 2380 Jan 31 16:43 attach_gdb.lib
-rw-r--r-- 1 root root 1834 Jun 25 16:25 __azurite_db_blob_extent__.json
-rw-r--r-- 1 root root 4241 Jun 25 16:25 __azurite_db_blob__.json
-rw-r--r-- 1 root root 2047602 Jun 25 16:36 azurite_log
lrwxrwxrwx 1 root root 7 Sep 11 2024 bin -> usr/bin
drwxr-xr-x 2 root root 4096 Jun 25 16:25 __blobstorage__
drwxr-xr-x 2 root root 4096 Apr 18 2022 boot
-rw-rw-r-- 1 1000 1000 292 Jun 25 16:02 broken_tests.json
drwxr-x--- 4 root root 4096 Jun 25 16:23 data
drwxr-xr-x 14 root root 3840 Jun 25 16:06 dev
-rwxr-xr-x 1 root root 0 Jun 25 16:06 .dockerenv
drwxr-xr-x 1 root root 4096 Jun 25 16:07 etc
drwxr-x--- 2 root root 4096 Jun 25 16:23 flags
drwxr-x--- 2 root root 4096 Jun 25 16:23 format_schemas
drwxr-xr-x 1 1000 1000 4096 Jun 25 16:07 hadoop-3.3.1
drwxr-xr-x 2 root root 4096 Apr 18 2022 home
lrwxrwxrwx 1 root root 7 Sep 11 2024 lib -> usr/lib
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib32 -> usr/lib32
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib64 -> usr/lib64
lrwxrwxrwx 1 root root 10 Sep 11 2024 libx32 -> usr/libx32
-rwxr-xr-x 1 root root 26927256 Jan 31 17:05 mc
drwxr-xr-x 2 root root 4096 Sep 11 2024 media
drwxr-x--- 2 root root 4096 Jun 25 16:23 metadata
drwxr-x--- 2 root root 4096 Jun 25 16:23 metadata_dropped
-rwxr-xr-x 1 root root 103174296 Jan 31 17:03 minio
drwxr-xr-x 4 root root 4096 Jun 25 16:07 minio_data
drwxr-xr-x 2 root root 4096 Sep 11 2024 mnt
drwxr-xr-x 1 root root 4096 Jan 31 16:44 opt
-rw-r--r-- 1 root root 0 Feb 14 2024 .package-cache-mutate
drwxrwxr-x 2 1000 1000 4096 Jun 25 16:06 package_folder
drwxr-x--- 2 root root 4096 Jun 25 16:26 preprocessed_configs
dr-xr-xr-x 313 root root 0 Jun 25 16:06 proc
-rwxrwxr-x 1 root root 9627 Jan 31 16:43 process_functional_tests_result.py
-rw-r--r-- 1 root root 29 Jun 25 16:11 queries_02352
-rw-r----- 1 root root 1 Jun 25 16:23 quotas.list
-rw-rw-r-- 1 root root 837 Jan 31 16:43 requirements.txt
-rw-r----- 1 root root 1 Jun 25 16:23 roles.list
drwx------ 1 root root 4096 Jun 25 16:34 root
-rw-r----- 1 root root 1 Jun 25 16:23 row_policies.list
drwxr-xr-x 1 root root 4096 Jun 25 16:07 run
-rwxrwxr-x 1 root root 22124 Jan 31 16:43 run.sh
lrwxrwxrwx 1 root root 8 Sep 11 2024 sbin -> usr/sbin
-rw-r--r-- 1 root root 747 Jun 25 16:07 script.gdb
-rw-r--r-- 1 root root 65727 Jun 25 16:27 server.log
-rw-r----- 1 root root 1 Jun 25 16:23 settings_profiles.list
-rwxrwxr-x 1 root root 10374 Jan 31 16:43 setup_export_logs.sh
-rwxrwxr-x 1 root root 360 Jan 31 16:43 setup_hdfs_minicluster.sh
-rwxrwxr-x 1 root root 3456 Jan 31 16:43 setup_minio.sh
drwxr-xr-x 2 root root 4096 Sep 11 2024 srv
-rw-r----- 1 root root 65 Jun 25 16:26 status
drwxr-x--- 4 root root 4096 Jun 25 16:23 store
-rw-rw-r-- 1 root root 14015 Jan 31 16:43 stress_tests.lib
dr-xr-xr-x 13 root root 0 Jun 25 16:06 sys
drwxrwxr-x 2 1000 1000 4096 Jun 25 16:07 test_output
drwxrwxrwt 1 root root 4096 Jun 25 16:36 tmp
drwxr-x--- 2 root root 4096 Jun 25 16:23 user_files
-rw-r----- 1 root root 1 Jun 25 16:25 users.list
drwxr-xr-x 1 root root 4096 Sep 11 2024 usr
-rw-rw-r-- 1 root root 897 Jan 31 16:43 utils.lib
-rw-r----- 1 root root 36 Jun 25 16:23 uuid
drwxr-xr-x 1 root root 4096 Sep 11 2024 var
+ echo 'Files in root directory'
+ ls -la /
Files in root directory
total 129392
drwxr-xr-x 1 root root 4096 Jun 25 16:29 .
drwxr-xr-x 1 root root 4096 Jun 25 16:29 ..
-rw-rw-r-- 1 1000 1000 119 Jun 25 16:02 analyzer_tech_debt.txt
-rw-rw-r-- 1 root root 2380 Jan 31 16:43 attach_gdb.lib
-rw-r--r-- 1 root root 1834 Jun 25 16:25 __azurite_db_blob_extent__.json
-rw-r--r-- 1 root root 4241 Jun 25 16:25 __azurite_db_blob__.json
-rw-r--r-- 1 root root 2047602 Jun 25 16:36 azurite_log
lrwxrwxrwx 1 root root 7 Sep 11 2024 bin -> usr/bin
drwxr-xr-x 2 root root 4096 Jun 25 16:25 __blobstorage__
drwxr-xr-x 2 root root 4096 Apr 18 2022 boot
-rw-rw-r-- 1 1000 1000 292 Jun 25 16:02 broken_tests.json
drwxr-x--- 4 root root 4096 Jun 25 16:23 data
drwxr-xr-x 14 root root 3840 Jun 25 16:06 dev
-rwxr-xr-x 1 root root 0 Jun 25 16:06 .dockerenv
drwxr-xr-x 1 root root 4096 Jun 25 16:07 etc
drwxr-x--- 2 root root 4096 Jun 25 16:23 flags
drwxr-x--- 2 root root 4096 Jun 25 16:23 format_schemas
drwxr-xr-x 1 1000 1000 4096 Jun 25 16:07 hadoop-3.3.1
drwxr-xr-x 2 root root 4096 Apr 18 2022 home
lrwxrwxrwx 1 root root 7 Sep 11 2024 lib -> usr/lib
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib32 -> usr/lib32
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib64 -> usr/lib64
lrwxrwxrwx 1 root root 10 Sep 11 2024 libx32 -> usr/libx32
-rwxr-xr-x 1 root root 26927256 Jan 31 17:05 mc
drwxr-xr-x 2 root root 4096 Sep 11 2024 media
drwxr-x--- 2 root root 4096 Jun 25 16:23 metadata
drwxr-x--- 2 root root 4096 Jun 25 16:23 metadata_dropped
-rwxr-xr-x 1 root root 103174296 Jan 31 17:03 minio
drwxr-xr-x 4 root root 4096 Jun 25 16:07 minio_data
drwxr-xr-x 2 root root 4096 Sep 11 2024 mnt
drwxr-xr-x 1 root root 4096 Jan 31 16:44 opt
-rw-r--r-- 1 root root 0 Feb 14 2024 .package-cache-mutate
drwxrwxr-x 2 1000 1000 4096 Jun 25 16:06 package_folder
drwxr-x--- 2 root root 4096 Jun 25 16:26 preprocessed_configs
dr-xr-xr-x 313 root root 0 Jun 25 16:06 proc
-rwxrwxr-x 1 root root 9627 Jan 31 16:43 process_functional_tests_result.py
-rw-r--r-- 1 root root 29 Jun 25 16:11 queries_02352
-rw-r----- 1 root root 1 Jun 25 16:23 quotas.list
-rw-rw-r-- 1 root root 837 Jan 31 16:43 requirements.txt
-rw-r----- 1 root root 1 Jun 25 16:23 roles.list
drwx------ 1 root root 4096 Jun 25 16:34 root
-rw-r----- 1 root root 1 Jun 25 16:23 row_policies.list
drwxr-xr-x 1 root root 4096 Jun 25 16:07 run
-rwxrwxr-x 1 root root 22124 Jan 31 16:43 run.sh
lrwxrwxrwx 1 root root 8 Sep 11 2024 sbin -> usr/sbin
-rw-r--r-- 1 root root 747 Jun 25 16:07 script.gdb
-rw-r--r-- 1 root root 65727 Jun 25 16:27 server.log
-rw-r----- 1 root root 1 Jun 25 16:23 settings_profiles.list
-rwxrwxr-x 1 root root 10374 Jan 31 16:43 setup_export_logs.sh
-rwxrwxr-x 1 root root 360 Jan 31 16:43 setup_hdfs_minicluster.sh
-rwxrwxr-x 1 root root 3456 Jan 31 16:43 setup_minio.sh
drwxr-xr-x 2 root root 4096 Sep 11 2024 srv
-rw-r----- 1 root root 65 Jun 25 16:26 status
drwxr-x--- 4 root root 4096 Jun 25 16:23 store
-rw-rw-r-- 1 root root 14015 Jan 31 16:43 stress_tests.lib
dr-xr-xr-x 13 root root 0 Jun 25 16:06 sys
drwxrwxr-x 2 1000 1000 4096 Jun 25 16:07 test_output
drwxrwxrwt 1 root root 4096 Jun 25 16:36 tmp
drwxr-x--- 2 root root 4096 Jun 25 16:23 user_files
-rw-r----- 1 root root 1 Jun 25 16:25 users.list
drwxr-xr-x 1 root root 4096 Sep 11 2024 usr
-rw-rw-r-- 1 root root 897 Jan 31 16:43 utils.lib
-rw-r----- 1 root root 36 Jun 25 16:23 uuid
drwxr-xr-x 1 root root 4096 Sep 11 2024 var
+ /process_functional_tests_result.py
2025-06-25 16:36:32,275 File /analyzer_tech_debt.txt with broken tests found
2025-06-25 16:36:32,276 File /broken_tests.json with broken tests found
2025-06-25 16:36:32,276 Broken tests in the list: 4
2025-06-25 16:36:32,276 Find files in result folder test_result.txt,gdb.log,run.log,minio.log,hdfs_minicluster.log
2025-06-25 16:36:32,289 Is flaky check: False
2025-06-25 16:36:32,289 Result parsed
2025-06-25 16:36:32,293 Result written
+ clickhouse-client -q 'system flush logs'
+ stop_logs_replication
+ echo 'Detach all logs replication'
Detach all logs replication
+ clickhouse-client --query 'select database||'\''.'\''||table from system.tables where database = '\''system'\'' and (table like '\''%_sender'\'' or table like '\''%_watcher'\'')'
+ tee /dev/stderr
+ timeout --preserve-status --signal TERM --kill-after 5m 15m xargs -n1 -r -i clickhouse-client --query 'drop table {}'
xargs: warning: options --max-args and --replace/-I/-i are mutually exclusive, ignoring previous --max-args value
+ failed_to_save_logs=0
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.query_log into outfile '\''/test_output/query_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.zookeeper_log into outfile '\''/test_output/zookeeper_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.trace_log into outfile '\''/test_output/trace_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.transactions_info_log into outfile '\''/test_output/transactions_info_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.metric_log into outfile '\''/test_output/metric_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.blob_storage_log into outfile '\''/test_output/blob_storage_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.error_log into outfile '\''/test_output/error_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ sleep 1
+ clickhouse-client -q 'SYSTEM FLUSH ASYNC INSERT QUEUE'
+ clickhouse-client -q 'SELECT log FROM minio_audit_logs ORDER BY event_time INTO OUTFILE '\''/test_output/minio_audit_logs.jsonl.zst'\'' FORMAT JSONEachRow'
+ clickhouse-client -q 'SELECT log FROM minio_server_logs ORDER BY event_time INTO OUTFILE '\''/test_output/minio_server_logs.jsonl.zst'\'' FORMAT JSONEachRow'
+ sudo clickhouse stop
script.gdb:13: Error in sourced command file:
No stack.
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 615.
The process with pid = 615 is running.
Sent terminate signal to process with pid 615.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 615.
The process with pid = 615 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 615.
The process with pid = 615 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 615.
The process with pid = 615 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 615.
The process with pid = 615 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 615.
The process with pid = 615 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 615.
The process with pid = 615 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 615.
The process with pid = 615 does not exist.
Server stopped
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ kill 1499
+ rg -Fa '' /var/log/clickhouse-server/clickhouse-server.log
+ :
+ rg -A50 -Fa ============ /var/log/clickhouse-server/stderr.log
+ :
+ data_path_config=--path=/var/lib/clickhouse/
+ [[ -n '' ]]
+ zstd --threads=0
+ '[' 0 -ne 0 ']'
+ for trace_type in CPU Memory Real
+ zstd --threads=0
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q '
select
arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack,
count(*) AS samples
from system.trace_log
where trace_type = '\''CPU'\''
group by trace
order by samples desc
settings allow_introspection_functions = 1
format TabSeparated'
+ for trace_type in CPU Memory Real
+ zstd --threads=0
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q '
select
arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack,
count(*) AS samples
from system.trace_log
where trace_type = '\''Memory'\''
group by trace
order by samples desc
settings allow_introspection_functions = 1
format TabSeparated'
+ for trace_type in CPU Memory Real
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q '
select
arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack,
count(*) AS samples
from system.trace_log
where trace_type = '\''Real'\''
group by trace
order by samples desc
settings allow_introspection_functions = 1
format TabSeparated'
+ zstd --threads=0
+ check_logs_for_critical_errors
+ sed -n '/WARNING:.*anitizer/,/^$/p' /var/log/clickhouse-server/stderr.log
+ rg -Fav -e 'ASan doesn'\''t fully support makecontext/swapcontext functions' -e DB::Exception /test_output/tmp
+ echo -e 'No sanitizer asserts\tOK\t\N\t'
+ rm -f /test_output/tmp
+ rg -Fa ' Application: Child process was terminated by signal 9' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ echo -e 'No OOM messages in clickhouse-server.log\tOK\t\N\t'
+ rg -Fa 'Code: 49. DB::Exception: ' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ echo -e 'No logical errors\tOK\t\N\t'
+ '[' -s /test_output/logical_errors.txt ']'
+ rm /test_output/logical_errors.txt
+ rg --text 'Code: 499.*The specified key does not exist' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ grep -v a.myext
+ echo -e 'No lost s3 keys\tOK\t\N\t'
+ grep SharedMergeTreePartCheckThread
+ rg -Fa 'it is lost forever' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ echo -e 'No SharedMergeTree lost forever in clickhouse-server.log\tOK\t\N\t'
+ '[' -s /test_output/no_such_key_errors.txt ']'
+ rm /test_output/no_such_key_errors.txt
+ rg -Fa '########################################' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ echo -e 'Not crashed\tOK\t\N\t'
+ rg -Fa ' ' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ echo -e 'No fatal messages in clickhouse-server.log\tOK\t\N\t'
+ '[' -s /test_output/fatal_messages.txt ']'
+ rm /test_output/fatal_messages.txt
+ rg -Faz '########################################' /test_output/blob_storage_log.tsv.zst /test_output/check_status.tsv /test_output/clickhouse-server.log.zst /test_output/error_log.tsv.zst /test_output/gdb.log /test_output/hdfs_minicluster.log /test_output/metric_log.tsv.zst /test_output/minio_audit_logs.jsonl.zst /test_output/minio.log /test_output/minio_server_logs.jsonl.zst /test_output/query_log.tsv.zst /test_output/run.log /test_output/test_results.tsv /test_output/test_result.txt /test_output/trace-log-CPU-flamegraph.tsv.zst /test_output/trace-log-Memory-flamegraph.tsv.zst /test_output/trace-log-Real-flamegraph.tsv.zst /test_output/trace_log.tsv.zst /test_output/transactions_info_log.tsv.zst /test_output/zookeeper_log.tsv.zst
+ rg -Fa ' received signal ' /test_output/gdb.log
+ dmesg -T
+ grep -q -F -e 'Out of memory: Killed process' -e 'oom_reaper: reaped process' -e oom-kill:constraint=CONSTRAINT_NONE /test_output/dmesg.log
+ echo -e 'No OOM in dmesg\tOK\t\N\t'
+ rm /var/log/clickhouse-server/clickhouse-server.log
+ mv /var/log/clickhouse-server/stderr.log /test_output/
+ [[ -n '' ]]
+ tar -chf /test_output/coordination.tar /var/lib/clickhouse/coordination
tar: Removing leading `/' from member names
tar: Removing leading `/' from hard link targets
+ rm -rf /var/lib/clickhouse/data/system/asynchronous_insert_log/ /var/lib/clickhouse/data/system/asynchronous_metric_log/ /var/lib/clickhouse/data/system/backup_log/ /var/lib/clickhouse/data/system/blob_storage_log/ /var/lib/clickhouse/data/system/crash_log/ /var/lib/clickhouse/data/system/error_log/ /var/lib/clickhouse/data/system/filesystem_cache_log/ /var/lib/clickhouse/data/system/metric_log/ /var/lib/clickhouse/data/system/opentelemetry_span_log/ /var/lib/clickhouse/data/system/part_log/ /var/lib/clickhouse/data/system/processors_profile_log/ /var/lib/clickhouse/data/system/query_log/ /var/lib/clickhouse/data/system/query_thread_log/ /var/lib/clickhouse/data/system/query_views_log/ /var/lib/clickhouse/data/system/s3queue_log/ /var/lib/clickhouse/data/system/session_log/ /var/lib/clickhouse/data/system/text_log/ /var/lib/clickhouse/data/system/trace_log/ /var/lib/clickhouse/data/system/transactions_info_log/ /var/lib/clickhouse/data/system/zookeeper_log/
+ tar -chf /test_output/store.tar /var/lib/clickhouse/store
tar: Removing leading `/' from member names
tar: Removing leading `/' from hard link targets
+ tar -chf /test_output/metadata.tar /var/lib/clickhouse/metadata/03147_db.sql /var/lib/clickhouse/metadata/default.sql /var/lib/clickhouse/metadata/empty_db_01036.sql /var/lib/clickhouse/metadata/information_schema.sql /var/lib/clickhouse/metadata/INFORMATION_SCHEMA.sql /var/lib/clickhouse/metadata/system.sql /var/lib/clickhouse/metadata/test_06bsporo.sql /var/lib/clickhouse/metadata/test_hsroii3h_1.sql /var/lib/clickhouse/metadata/test_ne5y56n5.sql /var/lib/clickhouse/metadata/test_qfw8lwmp.sql /var/lib/clickhouse/metadata/test.sql
tar: Removing leading `/' from member names
tar: Removing leading `/' from hard link targets
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ collect_core_dumps
+ find . -type f -maxdepth 1 -name 'core.*'
+ read -r core